Details for Kale Locus Bo5g109680

Position : C5 ( 5`- 33988368 .. 33989938 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g109680

Protein [Map View]
MDRLIRFFSPDFNSPTITPSNFSPSVNYRAITRPPLSPEKMESLQAVEKIVNYSFANKSLLEEALTHTSCVDFPSYERLE
FVGDSAIGLALTNYLYLTYPNAEPHELSQLRAANVSTEKFARVALKHGLYRFLRRNAPSLDEKVTEFSEAVCKEDDSVYY
GGLVKAPKVLADLLESVAGAVYIDVNFDLQRFWVIFRGLLEPIFTLDDLQQQPQPISMLFQLCHKHGKRLAIRYLKEGKR
NIAGVYLDDEFFASGSAENKDTAKLLAAKEALGKFSECSPIAMVIDEGSVEVDLEDAKRKLYEICSKKKWPKPIYSIEEE
RGSANGKRFVCSARIKIPSEESPLYMKGDEESKKKKAENSSAYHMIIALRKSNYL*

DNA
ATGGATCGCTTGATTCGCTTCTTCTCGCCGGATTTCAACTCTCCGACGATCACTCCCTCTAACTTCTCACCTTCAGTCAA
TTATCGGGCGATCACTCGCCCTCCTCTATCGCCGGAGAAGATGGAATCTCTGCAAGCTGTGGAGAAGATCGTCAACTACA
GTTTCGCTAACAAGAGTCTTCTCGAGGAAGCGCTTACGCACACTTCTTGCGTCGACTTTCCTTCGTACGAAAGGCTTGAA
TTCGTAGGAGACAGCGCCATAGGTCTTGCCTTAACGAACTACTTGTACCTCACTTACCCTAACGCCGAACCGCACGAGCT
GTCTCAGTTGAGAGCTGCTAATGTTAGCACCGAGAAATTCGCCCGTGTCGCACTCAAACACGGTCTCTACCGCTTTCTTC
GTCGCAACGCTCCTTCTTTAGATGAAAAGGTTACAGAGTTCTCAGAGGCGGTGTGCAAAGAAGACGATTCAGTTTACTAT
GGTGGATTAGTGAAAGCTCCCAAAGTTCTCGCTGACCTCCTAGAGTCTGTAGCCGGAGCCGTTTACATAGATGTCAACTT
TGATCTGCAAAGATTCTGGGTGATCTTCAGGGGTCTTTTGGAACCTATATTTACACTGGATGATCTCCAGCAGCAACCTC
AGCCTATTAGTATGCTTTTCCAGTTATGTCATAAACACGGCAAGAGACTCGCCATCAGGTATCTGAAAGAGGGCAAAAGA
AATATCGCTGGTGTATATCTCGATGACGAGTTTTTTGCTTCTGGGAGTGCTGAGAACAAAGATACCGCCAAGCTGTTAGC
TGCTAAGGAAGCACTAGGGAAGTTTTCAGAATGTTCGCCTATTGCAATGGTTATTGATGAGGGTAGTGTAGAGGTTGACC
TTGAAGATGCCAAAAGGAAGTTGTATGAGATTTGCTCCAAGAAAAAGTGGCCTAAACCAATTTACAGTATTGAGGAAGAA
AGAGGGTCGGCAAATGGGAAGAGATTTGTGTGTTCAGCTAGAATAAAGATCCCTAGTGAAGAGAGTCCGTTATATATGAA
GGGGGATGAAGAATCCAAGAAAAAGAAAGCTGAAAACTCCTCAGCTTACCACATGATAATAGCTCTAAGGAAATCTAATT
ATCTCTAG