Details for Kale Locus Bo5g108670

Position : C5 ( 5`- 33962203 .. 33967992 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g108670

Protein [Map View]
MVSLSNQTSFSFYPNNVFVSDKTRLGIPGINFPRKIKVKVTCFAADQPRQQKQQKKKKSQSTNSDAESGVDPVGFLTKLG
IADRIFAQFLRERHKALKDLKDELLKRHFDLRDLASGFELLGMHRHMEHRVDFMDWGPGARYGAIIGDFNGWSPTENSAR
EGLFGHDDFGYWFIILEDKLREGEEPEELYFQQYNYVDDYDKGDSGVTAEEVFQRANDEYWEPGEDRFIKNRYEVPAKLY
EQLFGPNSPQTLEDLGEIPDAETRYKQYKEEHKNDPPSNLPPCDIIDDGRGKPYDIYNVVTSPEWTKKFYEKSPPIPYWL
ETRKGRKAWLEKYIPAVPHGSKYRLYFNTPDGPLERVPAWATYVQPEDEGKQAYAIHWEPSPESAYKWKHTKPDKPKSLR
IYECHVGISGSEAKISSFEEFTKKVLPHVKRAGYNAIQLIGIPEHKDYYTVGYRVTNFFAVSNRFGTPDDFKRLVDEAHG
LGLLVFLDIVHSYAAADQMVGLSLFDGSNDCYFHHGKRGHHKHWGTRMFKYGDLDVFHFLISNLNWWITEYQVDGYQFHS
LASMIYTHNGFAPFNSGFDDYCNQYVDRDALMYLILANEILHDLHPDIITIAEDATYYPGLCEPVSQGGLGFDYYVNLSA
TEMWVSLLDSVPDSEWSMSKIVSTLVANKEYADKMLSYAESHNQSISGGRSFAEILLGGVQNENKLLDRGVSLHKMIRLL
TFTIGGRAYLNFMGNEFGHPERVEFPTQSNKFSFSLANRRWDLLESGIHHQLFSFDKDLMDLDKSKGILSRGLPSIHHVN
DTNMVISFSRGPFLFIFNFHPSNSYEKYGAGVEEAGEYTMILNSDEAKYGGQGLLKEDQYLQRSISKRIDGQRNCLEVFL
PSRTAQVYKLTRILRI*

DNA
ATGGTTTCCCTCTCTAACCAAACCTCGTTTTCTTTCTACCCAAACAACGTTTTCGTTTCCGACAAGACCCGCCTGGGCAT
CCCCGGAATCAACTTTCCCAGAAAAATCAAGGTGAAAGTCACATGCTTCGCCGCCGACCAACCGCGCCAGCAAAAGCAAC
AGAAGAAGAAGAAGAGTCAGAGCACTAATAGCGATGCCGAGTCTGGAGTCGACCCAGTTGGGTTTCTCACCAAACTCGGA
ATCGCTGACAGAATCTTCGCTCAGTTTCTCCGTGAAAGGCACAAAGCTTTAAAAGACCTTAAAGATGAGCTTCTCAAACG
TCACTTCGATCTCAGAGATCTTGCTTCAGGGTTTGAGTTACTAGGGATGCATAGACACATGGAACACCGTGTTGATTTCA
TGGACTGGGGTCCAGGTGCTCGTTACGGTGCTATAATCGGAGACTTCAACGGATGGTCTCCAACAGAAAACTCCGCCAGA
GAAGGCCTATTTGGCCATGATGACTTTGGCTATTGGTTCATTATCCTTGAAGATAAGTTAAGAGAAGGCGAGGAGCCAGA
GGAACTATACTTCCAGCAGTACAACTACGTCGATGACTATGATAAAGGCGACAGCGGTGTAACAGCGGAAGAGGTTTTTC
AGAGAGCCAATGATGAGTACTGGGAGCCTGGTGAGGACCGTTTTATCAAGAACCGTTACGAAGTTCCTGCGAAACTATAC
GAGCAGCTGTTTGGTCCCAACAGTCCACAGACGTTAGAAGATCTAGGTGAGATACCGGACGCAGAGACGAGGTATAAGCA
GTACAAAGAGGAGCATAAGAATGATCCACCAAGTAATCTACCACCGTGCGACATCATTGATGACGGTCGAGGCAAGCCAT
ATGATATCTATAACGTCGTGACATCTCCGGAATGGACTAAGAAGTTTTATGAGAAATCACCTCCGATTCCATATTGGTTA
GAGACGCGTAAAGGAAGGAAGGCGTGGTTGGAAAAGTACATTCCTGCTGTTCCACATGGAAGCAAGTATAGATTGTATTT
CAACACTCCTGATGGTCCGCTTGAAAGGGTGCCTGCTTGGGCTACATATGTGCAACCAGAGGACGAGGGAAAGCAAGCTT
ATGCAATTCACTGGGAACCTTCTCCTGAGTCTGCATACAAATGGAAACACACCAAGCCGGACAAACCAAAGTCCTTGCGC
ATATACGAATGTCATGTTGGAATCAGTGGGTCTGAGGCAAAAATTTCATCTTTCGAGGAATTTACCAAGAAGGTCCTTCC
TCATGTGAAAAGAGCAGGATACAATGCGATCCAGTTGATTGGTATCCCTGAGCACAAGGATTATTATACTGTCGGCTATA
GGGTTACTAATTTCTTTGCTGTCAGTAACCGATTTGGAACCCCAGATGACTTCAAACGCTTAGTTGATGAAGCACATGGC
CTAGGACTCCTTGTCTTCTTAGACATTGTGCATTCTTATGCAGCAGCTGATCAAATGGTTGGGCTTTCGCTTTTTGATGG
TTCAAATGATTGCTATTTTCATCATGGTAAAAGGGGGCATCACAAACACTGGGGCACACGGATGTTCAAATACGGCGACT
TGGATGTTTTTCATTTTCTCATTTCAAATCTGAACTGGTGGATTACAGAGTATCAAGTTGATGGTTACCAATTTCACTCG
CTTGCCTCGATGATCTACACGCACAATGGTTTTGCTCCTTTTAATAGCGGTTTTGATGACTATTGCAATCAGTATGTTGA
CCGAGATGCTCTGATGTACCTCATTTTGGCCAATGAAATCTTGCACGATCTACATCCAGATATAATAACAATTGCTGAAG
ATGCAACATATTATCCTGGGTTGTGTGAGCCAGTTTCTCAAGGTGGACTAGGATTTGATTATTATGTGAACCTTTCTGCG
ACAGAAATGTGGGTTTCTCTCCTTGACAGCGTACCGGATAGTGAATGGAGCATGAGCAAGATTGTCAGTACATTGGTGGC
TAACAAAGAGTATGCAGACAAGATGCTCAGCTATGCCGAAAGTCACAACCAATCCATATCAGGAGGGCGTTCATTTGCTG
AAATCTTGTTAGGTGGAGTCCAAAATGAGAATAAGTTGCTAGACAGGGGCGTTTCACTACATAAGATGATTAGACTTCTT
ACTTTTACAATTGGTGGCCGTGCTTACCTCAACTTCATGGGAAATGAATTTGGACATCCTGAGAGGGTTGAGTTTCCTAC
ACAGAGCAATAAATTCTCGTTTTCACTGGCTAACCGCCGCTGGGACCTGCTGGAAAGTGGAATCCATCATCAGTTGTTTT
CCTTTGACAAGGACCTAATGGACTTGGATAAAAGCAAGGGCATCCTTTCAAGAGGTCTGCCCAGCATCCACCATGTTAAT
GATACAAATATGGTAATTTCATTCTCGAGGGGTCCTTTCTTGTTTATCTTTAACTTCCACCCATCGAATTCATATGAAAA
GTATGGTGCCGGCGTAGAGGAAGCTGGTGAATACACCATGATACTGAACTCAGATGAAGCGAAATATGGGGGTCAGGGAC
TTCTAAAGGAGGACCAGTATCTTCAACGGTCGATTAGCAAGAGAATTGATGGTCAAAGAAATTGCTTAGAGGTGTTTTTG
CCAAGCAGGACTGCACAAGTTTACAAGTTGACCCGGATTCTCCGAATATGA