Details for Kale Locus Bo5g108660

Position : C5 ( 5`- 33953958 .. 33954530 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g108660

Protein [Map View]
MFIEMFQLLFTIVAVEAALILTLGFGTPVRRVVVKLLDLLKQGRGPLVTKTVAATMLVLFGSVLFSTIQINTRVSESGGV
ANPTDQVMFANRILESFLMGTVLFLALVMDRMHYYTRELQITRRNLEVAVKKTKTAA*

DNA
ATGTTCATAGAGATGTTTCAGCTTCTGTTCACGATCGTGGCGGTTGAAGCCGCCCTGATCTTAACACTCGGGTTTGGGAC
TCCAGTAAGAAGAGTGGTGGTGAAATTGCTTGACCTGCTGAAGCAAGGCCGAGGACCACTGGTTACAAAGACGGTTGCAG
CCACTATGCTTGTGTTGTTTGGCTCGGTTCTGTTCAGCACGATTCAGATCAACACAAGAGTCTCTGAGTCTGGTGGTGTA
GCTAACCCGACTGATCAAGTCATGTTTGCGAATCGCATCCTCGAATCTTTCCTCATGGGGACTGTGTTGTTCTTGGCATT
GGTGATGGACAGAATGCATTACTACACCAGAGAGCTTCAAATCACAAGAAGAAACTTGGAGGTTGCAGTAAAGAAGACCA
AAACAGCTGCTTAA