Details for Kale Locus Bo5g108620

Position : C5 ( 5`- 33925322 .. 33925873 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g108620

Protein [Map View]
MASKSMLLVALLVGSLALTSFASVPNRKLKSGLEDQKTFFHHPGGGLGGGGGLGGGGGLGGGGGLGGGSGLGGGGGLGGG
GGLGGGAGGGLGGGAGGGGGLGGGAGGGGGLGGGAGGGAGGGFGGGAGGGAGGGAGGGFGGGAGGGGGLGGGGGAGGGFG
GGAGGGFGGGAGAGGGYGASGLP*

DNA
ATGGCTTCCAAGTCAATGCTTCTTGTTGCCTTACTTGTCGGTTCTTTAGCTCTCACTTCATTTGCTAGTGTCCCTAACAG
GAAGCTTAAGAGTGGTCTCGAGGATCAAAAGACGTTCTTCCACCATCCAGGCGGTGGTCTTGGTGGAGGCGGTGGCCTTG
GAGGAGGAGGCGGCCTTGGTGGAGGAGGCGGCCTTGGTGGAGGAAGCGGCCTTGGTGGAGGAGGTGGTCTTGGCGGAGGA
GGCGGCCTTGGCGGAGGAGCTGGTGGCGGTTTAGGTGGAGGAGCTGGAGGCGGTGGTGGTTTAGGTGGAGGAGCTGGAGG
TGGCGGTGGTTTAGGTGGAGGAGCTGGTGGTGGAGCAGGAGGAGGATTTGGCGGAGGAGCTGGAGGTGGTGCTGGTGGAG
GTGCTGGTGGTGGATTTGGAGGTGGAGCTGGTGGTGGAGGTGGACTCGGAGGTGGAGGTGGAGCCGGTGGTGGATTTGGA
GGAGGAGCAGGTGGTGGATTCGGTGGTGGAGCGGGTGCTGGTGGTGGTTACGGCGCCAGTGGACTTCCATGA