Details for Kale Locus Bo5g108610

Position : C5 ( 5`- 33889787 .. 33896894 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g108610

Protein [Map View]
MEETETESQVYMACIQHGRRVGVSYYDCSVRQLHVLEFWEEDCSDFTLINMVKYQAKPLVIYTSTKSEDSFVSALHKSDG
TDEDSTVKLVKSSTFSYEQAWHRLVYLRVTGMDEGLNIKERVCYLSSMMDVGSEVQVRVSGGLLAILESERIVDTLEQNE
SGTASIAIDSVMEVPLNKFLKLDAAAHEALQIFQTDKHPSHMGIGRAKEGFSVFGMMNKCATPMGRRLLRSWFMRPILDL
EVLDRRLNAITFFISSIELMTSLRDTLKSVKDISHLLKKFNSPTSLCTSNDWTAFMKSIGALLHVNKIFEVGVSESLREH
MRRFNLDIIEKAGLCISTELDHVYELVLGVIDVTRCKEKGYQTLVKDGFCAELDELRQIYEGLPEFLQEVSSMEFEHLPH
LHKENLPPCIVYIQQIGYLMCIFGEKLEEIALDRIKEFEFSFSDLDGETHRFFYHTPKTRELDNVLGDIYHKILDMERAI
IRDLLSHTLLFSAHLLKAVNFVAELDCILSLACVAHQNNYVRPVLTMESLLDIRNGRHVLQEMAVDTFIPNDTEINDNGR
IHIITGPNYSGKSIYVKQVALIVFLSHIGSFVPADAATVGLTDRIFCAMGSKFMTAEQSTFMIDLHQVGMMLRQATSRSL
CLLDEFGKGTLTEDGIGLLGGTISHFASCNEPPRVLVCTHLTELLDESCLPVSEKIRFYTMSVLRPDTESANMEEIVFLY
RLIPGQTLLSYGLHCALLAGVPEEVVKRAAIVLDIFESNNNVDKLNLDNISFQDQAFKDAVDKFMEFDISKGDIRAFFED
MFTS*

DNA
ATGGAGGAAACGGAAACCGAATCGCAGGTTTATATGGCTTGCATTCAGCACGGTCGTCGAGTTGGAGTTTCGTACTACGA
CTGTAGTGTACGCCAGCTTCATGTGCTTGAATTTTGGGAGGAAGATTGCTCTGATTTTACTCTGATCAATATGGTCAAAT
ATCAAGCGAAGCCATTGGTCATTTACACAAGCACCAAAAGTGAAGATTCCTTTGTATCCGCTCTGCACAAGAGTGATGGA
ACTGACGAGGATTCCACGGTGAAGCTGGTAAAGAGCTCAACATTCAGCTACGAGCAAGCGTGGCACAGGCTTGTATATCT
TCGAGTAACAGGAATGGATGAAGGGCTAAACATCAAAGAACGGGTTTGTTATCTGAGTTCAATGATGGATGTAGGCAGTG
AAGTCCAAGTTCGTGTTAGTGGGGGTCTTCTTGCCATATTAGAAAGCGAACGAATTGTAGATACCCTGGAACAAAACGAA
TCTGGGACAGCGTCAATTGCAATTGACTCAGTCATGGAAGTACCATTGAACAAGTTTCTTAAACTTGATGCAGCTGCTCA
CGAGGCACTACAGATATTTCAAACAGATAAACATCCAAGCCATATGGGCATTGGCAGGGCAAAAGAAGGGTTCTCGGTGT
TTGGCATGATGAATAAGTGTGCCACACCAATGGGTAGACGGCTTTTAAGAAGCTGGTTTATGAGGCCAATTCTGGATCTT
GAAGTGTTAGACCGTCGTCTCAATGCTATTACCTTTTTCATATCTTCTATAGAGCTGATGACATCTTTGCGGGATACACT
GAAATCTGTGAAGGACATATCCCATTTGCTCAAGAAATTCAACTCCCCGACGTCCTTGTGTACCAGTAATGATTGGACAG
CTTTTATGAAGAGTATAGGTGCGCTCTTGCACGTGAATAAGATATTTGAAGTTGGAGTCTCAGAAAGTCTCCGAGAGCAT
ATGAGACGCTTCAACTTAGACATTATTGAGAAGGCTGGCTTATGTATCAGCACAGAGCTAGATCATGTATATGAACTGGT
ACTTGGAGTCATTGATGTAACTAGATGCAAAGAGAAGGGTTATCAAACATTGGTTAAAGATGGATTCTGTGCTGAGTTGG
ATGAGCTGAGGCAAATATACGAGGGGTTGCCGGAGTTCCTGCAAGAGGTTTCATCGATGGAGTTTGAACACTTACCTCAT
CTGCATAAGGAGAATCTCCCTCCTTGTATTGTCTATATTCAACAAATTGGGTACCTCATGTGTATTTTTGGAGAAAAACT
TGAAGAAATTGCACTTGATAGGATTAAAGAATTTGAATTTTCGTTCTCTGATCTGGATGGGGAGACTCATCGATTCTTTT
ATCATACTCCAAAGACAAGAGAGTTAGACAACGTGCTTGGAGATATCTACCACAAAATTTTAGATATGGAGAGAGCTATT
ATAAGGGACTTGCTATCGCACACACTTTTGTTCTCGGCACACCTGTTGAAGGCAGTTAATTTTGTTGCAGAACTTGATTG
CATTTTATCGTTGGCTTGTGTAGCCCATCAGAATAACTACGTAAGGCCTGTTCTGACAATGGAATCATTGCTTGATATTC
GGAATGGAAGGCATGTTTTGCAGGAAATGGCAGTGGATACATTTATCCCCAACGATACTGAAATAAATGATAACGGTCGA
ATTCATATCATTACCGGTCCTAATTACTCAGGAAAGAGCATATATGTGAAGCAGGTGGCTTTAATTGTTTTCCTATCTCA
TATTGGAAGCTTTGTACCAGCAGATGCTGCAACTGTTGGTTTAACTGACAGGATCTTTTGTGCAATGGGAAGCAAGTTCA
TGACCGCGGAGCAATCTACATTTATGATTGATCTACATCAAGTGGGAATGATGCTAAGGCAGGCAACTTCAAGATCTCTG
TGTCTCTTGGACGAGTTTGGTAAAGGCACTCTTACAGAAGATGGTATTGGCTTGCTTGGTGGGACAATTAGTCACTTTGC
TTCATGTAATGAGCCACCAAGGGTTCTAGTATGCACCCACTTGACTGAACTACTTGACGAGAGCTGCTTGCCCGTTTCTG
AGAAGATACGATTCTACACAATGAGCGTTCTGAGGCCAGATACAGAATCTGCAAACATGGAAGAAATTGTCTTTCTTTAT
CGGTTAATCCCGGGACAAACGCTGCTGAGTTACGGTCTACATTGTGCACTACTCGCTGGTGTCCCAGAGGAAGTGGTGAA
GAGAGCAGCCATCGTGTTGGACATCTTTGAGAGTAACAACAACGTGGATAAACTTAACCTTGACAACATATCGTTTCAAG
ATCAAGCATTCAAGGATGCTGTTGACAAGTTTATGGAGTTTGATATCAGTAAAGGTGATATCCGTGCTTTCTTTGAAGAC
ATGTTCACTTCTTAA