Details for Kale Locus Bo5g108600

Position : C5 ( 5`- 33886778 .. 33888993 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g108600

Protein [Map View]
MERTLLVTFSLILFASVAADDYVRPKPRQALQFPWKQKSTSQPEQVHISLAGDKHMRVSWVTNDKSSPSFVEYGTSPGKY
SFLGQGESTSYSYIFYRSGKIHHAVIGPLEPDTVYYYRCGGGGPEFHLKTPPSRFPITFAVAGDLGQTGWTKSTLDHIDQ
CKYEVHLLPGDLSYADYMQHKWDTFGELVQPLASVRPWMVTQGNHEKENIPFVVDEFVSYNSRWKMPYAESGSNSNLYYS
FEVAGVHVIMLGSYTDYDRYSDQYNWLKGDLAKVDRERTPWLIALFHVPWYNSNDAHQNEGDGMMAEMEPLLYASGVDIV
FTGHVHAYERTKRVNNGKSDPCGPVHITIGDGGNREGLARKYKDPSPEWSVFREASFGHGELQMVNSTHAHWTWHRNDDD
EPTKSDEVWLTSLVNSGCWTEKKWNENLRKILMEP*

DNA
ATGGAAAGAACGCTGCTTGTGACCTTCTCTTTGATACTCTTTGCTTCTGTGGCGGCAGATGACTATGTCCGACCAAAGCC
TCGTCAAGCCTTGCAGTTTCCATGGAAACAAAAATCCACTTCTCAACCCGAGCAGGTGCATATCTCATTGGCTGGAGACA
AACACATGCGAGTGAGTTGGGTCACCAACGACAAATCTTCCCCTTCCTTTGTTGAATACGGAACATCGCCAGGGAAATAC
TCTTTTCTCGGTCAAGGAGAGAGCACCTCTTACAGCTACATATTCTACAGATCAGGGAAGATACACCATGCCGTCATCGG
CCCGTTGGAACCGGACACCGTTTACTATTACCGTTGCGGTGGAGGAGGACCTGAGTTTCATCTCAAAACACCACCATCTC
GGTTCCCGATCACTTTCGCAGTGGCTGGTGATCTTGGTCAAACCGGTTGGACCAAGTCGACGCTAGATCATATCGACCAA
TGCAAATACGAAGTGCATCTGCTTCCCGGTGATCTTTCTTATGCCGACTATATGCAGCACAAGTGGGACACGTTTGGAGA
GCTGGTTCAGCCTCTGGCGAGTGTGAGGCCCTGGATGGTGACTCAGGGGAACCATGAGAAAGAGAATATTCCCTTTGTGG
TGGATGAGTTTGTGTCGTATAACTCGAGGTGGAAGATGCCGTATGCGGAGAGTGGATCAAATTCGAATCTTTATTACTCT
TTTGAGGTTGCTGGTGTACACGTGATCATGCTTGGCTCATACACTGATTATGATCGGTACTCAGATCAGTACAATTGGTT
AAAGGGTGATCTCGCAAAGGTGGACCGAGAAAGGACTCCGTGGCTAATAGCCTTGTTCCATGTGCCGTGGTATAATAGTA
ACGATGCCCATCAAAATGAAGGCGATGGGATGATGGCTGAAATGGAGCCTTTGCTTTATGCGAGCGGGGTTGATATTGTA
TTCACTGGTCATGTTCATGCTTATGAACGCACGAAACGTGTCAACAATGGTAAATCAGATCCATGTGGTCCTGTGCATAT
AACTATAGGAGATGGAGGAAACAGAGAAGGACTAGCTCGCAAGTATAAAGATCCGTCACCAGAGTGGTCAGTCTTCAGGG
AAGCAAGCTTTGGACATGGCGAACTTCAGATGGTGAATTCAACCCATGCGCATTGGACCTGGCATAGGAACGATGATGAT
GAGCCAACAAAATCTGATGAGGTTTGGTTAACATCCCTTGTGAACTCAGGATGTTGGACGGAGAAGAAATGGAATGAAAA
CCTCAGGAAAATACTCATGGAACCTTGA