Details for Kale Locus Bo5g108570

Position : C5 ( 5`- 33868860 .. 33873134 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g108570

Protein [Map View]
MGVSLRHFSPSSFWVSGRPRASSSVLSLLVPRHRILTRKVVITNGNARYCSASASGGSHGFQHSGRQGSSSTVEFSGEWK
LSVGSKTAIMVPPTVKLTGAVSAWRKGEVNQDDASGNGSNYFRSFVPKIDYGNYQTLDNQLESRGDVVTTVDRELNGFAQ
QKSQRGPLVALPREKIDDKNTVSISKVGKRTDLSKVRANLTKIYNKVRVVDSVSTAKEIVTKLVNQYRDLVHACDTEVSR
IDVKSETPVDHGELICFSIYCGSEADFGDGKSCIWVDVLGENGKDVLAEFKPFFEDSSIKKVWHNYSFDNHIIRNYGINL
SGFHGDTMHMARLWDSSRQTSGGYSLEALTSDPRVLGGTDTKEEAELFGKVSMKTIFGKGKLKKDGTEGKVVVIPPVEEL
QKDDREAWISYSALDSISTLKLYESMKKQLQAKKWFLDGKLVSGKNMFDFYQEFWQPFGELLAKMEAEGMLIDREYLAQI
EVVAKAEQEVAVSRFRSWASKHCPDAKHMNVGSDTQLRQLFFGGISNSCSGEDLPYEKLFKVPNVDNVIEEGKKRATKFR
NIKLHRISDNPLPTEKFTASGWPSVSGATLKALAGKVSAAYDFTEVAADDNSLEENMGGDEEFMSLPDEILETENSDTSA
FGTAFDAFGGGESGKEACHAIASLCEVCSIDSLISNFILPLQGSNVSGKDGRVHCSLNINTETGRLSARRPNLQNQPALE
KDRYKIRQAFIASPGNSLIVADYGQLELRILAHLARCKSMMEAFVAGGDFHSRTAMNMYPHIREAVENGQVLLEWHPQPG
QEKPPVPLLKDAFASERRKAKMLNFSIAYGKTAIGLSRDWKVSVEEAQETVNLWYNDRQEVRKWQELRKKEAIQNGYVLT
LLGRARKFPAYRSRAQKNHIERAAINTPVQGSAADVAMCAMLEITTNERLNELGWKLLLQVHDEVILEGPSESAELAKSI
VVDCMCKPFNGKNILSVDLSVDAKCAQNWYAAK*

DNA
ATGGGGGTCTCTCTCCGCCACTTTTCTCCCTCTTCTTTCTGGGTCTCGGGCCGTCCTCGCGCTTCTTCTTCCGTTCTTTC
GTTACTCGTTCCTCGCCATAGAATCCTTACCAGAAAAGTAGTTATCACAAATGGAAATGCTAGATATTGCAGTGCTTCAG
CTTCTGGTGGTTCCCATGGGTTTCAGCATTCAGGTCGTCAAGGGTCTTCTTCTACTGTTGAGTTTAGCGGAGAGTGGAAA
CTTAGTGTTGGATCTAAGACTGCCATAATGGTTCCACCAACTGTGAAACTAACCGGTGCTGTAAGTGCTTGGAGAAAAGG
GGAAGTCAATCAGGATGATGCTTCTGGTAACGGCAGTAACTATTTCAGAAGCTTCGTCCCAAAGATAGATTATGGAAACT
ACCAGACCTTGGATAACCAGCTAGAATCCAGAGGTGACGTTGTTACCACGGTTGATAGAGAGTTGAATGGCTTTGCGCAA
CAGAAGAGTCAAAGAGGACCTCTCGTAGCGTTGCCAAGGGAGAAGATAGATGACAAGAATACGGTATCCATTTCCAAAGT
GGGAAAACGGACCGACCTGTCCAAAGTCCGTGCGAACCTTACAAAAATATATAATAAGGTTCGTGTTGTGGATAGTGTGT
CTACCGCAAAGGAAATTGTGACTAAGCTCGTGAATCAATATAGGGATCTCGTCCATGCGTGCGATACAGAGGTGTCGAGG
ATTGATGTGAAGAGTGAAACACCTGTGGACCATGGCGAGCTTATATGTTTCAGTATATATTGTGGATCAGAAGCTGACTT
TGGAGATGGAAAGTCATGTATATGGGTGGATGTTCTTGGCGAAAATGGCAAGGATGTCTTGGCTGAGTTTAAGCCATTTT
TCGAAGACTCATCCATAAAAAAAGTATGGCATAACTACAGCTTTGATAACCACATTATAAGAAATTACGGAATCAACCTT
TCTGGTTTTCATGGTGATACAATGCACATGGCACGATTGTGGGATTCGTCTAGACAGACATCGGGTGGTTATTCGCTGGA
AGCACTCACAAGTGACCCAAGAGTTCTTGGGGGAACTGATACAAAGGAGGAAGCAGAACTATTCGGTAAAGTATCAATGA
AGACGATCTTCGGCAAGGGGAAACTGAAGAAAGATGGAACCGAGGGGAAAGTGGTGGTCATCCCACCTGTTGAAGAGCTG
CAAAAGGATGATCGAGAAGCTTGGATTTCGTACTCTGCACTGGATTCCATAAGCACACTAAAGCTTTACGAGAGCATGAA
GAAACAACTGCAAGCGAAGAAATGGTTTCTTGATGGGAAGCTGGTTTCGGGAAAGAACATGTTTGACTTTTACCAAGAGT
TTTGGCAACCTTTCGGTGAGCTTCTTGCTAAAATGGAAGCGGAGGGGATGCTAATAGATAGGGAGTATCTTGCGCAGATT
GAGGTTGTAGCCAAGGCAGAACAGGAAGTTGCTGTTTCTAGGTTCCGGAGTTGGGCCTCGAAGCATTGTCCTGATGCAAA
GCATATGAATGTTGGCAGTGATACGCAATTGAGACAGCTCTTTTTCGGTGGCATTTCTAACAGTTGTAGTGGTGAGGATC
TTCCATATGAAAAGCTGTTCAAAGTCCCCAATGTTGATAACGTGATTGAAGAAGGCAAAAAAAGAGCCACAAAGTTCCGG
AACATCAAACTGCATAGGATTAGTGACAATCCTCTGCCTACTGAAAAGTTCACCGCCTCAGGGTGGCCTTCTGTTAGTGG
AGCTACTTTGAAAGCCTTAGCTGGGAAAGTCTCTGCAGCTTACGACTTTACAGAGGTCGCTGCAGATGATAATTCTCTAG
AAGAAAACATGGGAGGAGATGAGGAGTTTATGTCGCTACCAGATGAAATTTTGGAAACGGAGAACTCAGATACATCTGCT
TTTGGAACAGCGTTTGATGCGTTTGGTGGGGGTGAAAGTGGAAAAGAGGCTTGCCATGCAATTGCTTCATTATGCGAAGT
TTGCTCCATTGATTCTTTAATATCAAATTTTATTCTTCCTCTGCAGGGAAGTAATGTGTCAGGCAAAGATGGTCGTGTCC
ACTGCTCCCTGAATATCAACACTGAAACTGGGAGGTTGTCAGCTAGAAGGCCAAATTTGCAGAACCAACCTGCGTTGGAG
AAAGATCGGTACAAGATCCGTCAGGCCTTTATAGCATCTCCTGGAAATTCTCTTATTGTTGCTGACTATGGGCAGCTGGA
ACTTAGGATTCTGGCACATCTTGCTCGCTGCAAAAGCATGATGGAAGCTTTCGTGGCCGGTGGTGACTTCCACTCGAGAA
CTGCCATGAATATGTATCCACATATTCGTGAAGCTGTCGAAAATGGTCAAGTGCTCCTTGAATGGCATCCCCAACCTGGA
CAGGAGAAGCCACCAGTGCCATTATTAAAGGACGCCTTTGCTTCTGAGAGAAGAAAAGCTAAGATGCTCAACTTTTCGAT
TGCGTATGGGAAGACTGCTATTGGGCTTTCTAGAGACTGGAAGGTTTCGGTAGAAGAAGCTCAAGAGACGGTTAATCTCT
GGTATAATGACAGACAAGAAGTCCGGAAATGGCAAGAACTACGCAAGAAAGAAGCTATACAAAATGGGTATGTGCTGACT
TTGTTGGGAAGGGCTCGTAAGTTCCCTGCGTACCGTTCACGTGCCCAAAAGAACCATATCGAACGAGCAGCAATCAACAC
TCCTGTTCAGGGAAGTGCGGCTGATGTTGCTATGTGCGCTATGCTGGAGATAACAACAAATGAACGTTTAAACGAGCTTG
GTTGGAAGCTGCTTCTACAAGTTCATGATGAAGTAATCTTGGAAGGACCAAGTGAATCAGCCGAGTTAGCTAAATCCATA
GTTGTGGACTGCATGTGTAAACCTTTCAACGGCAAGAACATTCTCTCAGTCGATTTGTCTGTTGATGCCAAGTGTGCTCA
GAACTGGTATGCTGCTAAGTAA