Details for Kale Locus Bo5g108550

Position : C5 ( 5`- 33861114 .. 33861752 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g108550

Protein [Map View]
MENSALSNVVRRTVISNQQRTIQEGLEESSWDMYVETEDGISHYEDSSMISDAASPIIYVEEDTASSPSNRTKGCSEMEN
NTTEIKIMNNSKTEEKGLNKKGIMNEEYCVELKKRGLCLVPLSMLYTYIG*

DNA
ATGGAAAACTCAGCACTAAGCAATGTCGTGAGGCGAACAGTAATCTCTAATCAACAGAGAACAATACAAGAGGGTCTAGA
AGAGAGTAGTTGGGATATGTACGTTGAAACCGAAGATGGTATCAGCCATTATGAAGATTCTTCCATGATCTCAGATGCTG
CGTCTCCTATAATCTATGTCGAAGAAGACACGGCTTCATCTCCGTCTAACAGAACCAAGGGTTGCAGTGAAATGGAGAAC
AATACGACAGAAATAAAAATCATGAACAATTCTAAAACTGAGGAGAAAGGATTGAATAAGAAAGGGATAATGAATGAAGA
ATATTGCGTAGAATTGAAGAAGAGAGGACTTTGTTTAGTGCCTTTGTCGATGTTGTACACCTACATTGGTTGA