Details for Kale Locus Bo5g108540

Position : C5 ( 5`- 33854649 .. 33858661 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g108540

Protein [Map View]
MVSPTKLKSMDFYRKIPRDLTEASLSGAGLSIVAALIMMLLFGMELSSYLAVNTTTTVVVDKSADGDFLRIHFNISFPAL
SCEFASIDVSDVLGTNRLNITKTVRKFPIDPHLKTTGEEFHSGHGSHHINHGEEIKEEIPDGAVPLVSGSFDSFTKHFPL
LIVNFNAPWCYWSNRLKPSWEKAASIIYHKYNPETDGRVLLGSVDCTEEAELCKRNHIQGYPSIRIFRKGSDLKEDHGHH
EHESYYGDRDTDSVVKMVDELVAPIHPETHKLDLDGISNETLKHLKKAPVTGGCRVEGYVRVKKVPGNLIISAHSGAHSF
DSSKMNMSHVVTHLSFGRMFSPRLLTDMRRLLPYIGQSHDKLDEKAFINQHEFGANVTIEHYLQVVKTEVITRRTAQEHS
LVEEYEYTAHSSIAQTYYLPVAKFHYELSPMQIVITENPKSFSHFITNLCAIIGGVFTVAGILDSIFHNTIRLVKKVELG
KNF*

DNA
ATGGTTTCCCCTACAAAACTCAAATCCATGGATTTCTACAGGAAAATCCCGAGAGATTTGACAGAGGCGTCTCTATCAGG
CGCTGGCTTATCCATCGTTGCTGCCCTCATTATGATGCTTTTGTTCGGAATGGAGCTGAGTAGTTATTTGGCAGTCAACA
CTACCACAACTGTCGTCGTTGACAAGAGCGCTGATGGTGACTTCTTACGCATTCATTTCAACATCAGTTTTCCTGCCCTT
TCATGTGAATTTGCATCCATTGATGTGAGTGACGTCTTGGGAACAAATAGGCTAAACATAACAAAAACAGTTCGCAAGTT
TCCAATTGATCCACATTTAAAGACCACTGGTGAAGAGTTCCACTCGGGCCATGGATCACATCACATCAACCACGGAGAAG
AAATTAAGGAAGAGATTCCTGATGGTGCCGTACCACTTGTCAGTGGTAGTTTTGATTCATTTACAAAACACTTTCCTCTA
TTGATTGTTAACTTTAATGCACCATGGTGCTACTGGAGTAACCGTCTGAAACCGTCTTGGGAGAAAGCAGCTTCAATTAT
ATACCACAAATATAATCCTGAAACTGATGGACGTGTTCTTCTCGGAAGCGTTGATTGCACAGAAGAAGCTGAACTATGTA
AGAGGAATCATATACAAGGCTATCCATCTATTCGGATTTTCCGCAAGGGCAGTGACCTTAAGGAGGACCATGGACATCAC
GAACATGAATCTTACTATGGAGATCGGGACACAGATAGTGTAGTTAAGATGGTGGATGAACTGGTCGCACCTATCCACCC
AGAGACTCACAAGCTAGATTTGGATGGTATATCCAATGAGACATTAAAACATCTTAAAAAGGCACCAGTTACTGGAGGTT
GTAGAGTTGAAGGTTATGTGCGTGTAAAGAAGGTTCCAGGAAACCTTATTATCTCAGCTCATTCAGGAGCTCATTCGTTC
GACTCTTCTAAAATGAACATGTCGCATGTTGTTACCCATCTTTCATTTGGGAGAATGTTTTCCCCTAGGCTGTTGACCGA
TATGAGGCGCTTGTTGCCATATATCGGCCAAAGCCATGACAAGCTCGATGAAAAAGCATTCATTAATCAACACGAGTTTG
GTGCCAACGTTACTATCGAGCACTACCTTCAAGTAGTCAAGACAGAGGTCATTACAAGAAGAACAGCTCAAGAACATTCA
TTGGTTGAGGAATATGAATACACCGCTCACAGCAGCATAGCTCAGACTTACTACTTACCGGTTGCAAAGTTTCACTATGA
GCTCTCTCCCATGCAGATTGTGATAACTGAAAACCCAAAGTCCTTCTCGCACTTCATCACAAACCTTTGCGCCATCATTG
GTGGTGTTTTCACGGTAGCGGGAATACTAGATTCTATTTTCCACAATACAATAAGACTGGTGAAAAAGGTGGAGCTGGGG
AAAAACTTTTGA