Details for Kale Locus Bo5g108530

Position : C5 ( 5`- 33853664 .. 33854377 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g108530

Protein [Map View]
MVRDLKNMTLRGFGLVCLFTIVSKAYAREFAVGGAKGWTVPSGSQVYSQWAEQSRFQIGDSLLFVYQPNQDSVLQVTRDA
YDSCNTDAPTAKFADGKTSFALTHSGPYYFISGNKDNCKKNEKLVVIVMADRNGNTTTSSPPLPSPAPAPSSLPPSPALA
PSAEPPPSPPPMTGPFETPAPTPTPTHETPNSAASPSSSFVAALLVAAFASTLFLH*

DNA
ATGGTTCGAGACCTAAAGAACATGACGCTTCGTGGATTCGGTCTTGTGTGTCTGTTCACGATCGTTAGCAAAGCCTACGC
TAGAGAGTTTGCGGTTGGTGGTGCAAAAGGTTGGACCGTCCCTTCAGGTTCTCAAGTTTACAGTCAATGGGCAGAGCAAA
GCAGATTCCAAATCGGCGACTCTCTGCTGTTCGTTTACCAACCAAACCAAGACTCAGTTCTCCAAGTCACAAGAGACGCC
TACGACAGCTGCAACACGGATGCACCAACCGCTAAGTTTGCTGATGGCAAAACTTCCTTCGCATTAACACACTCTGGACC
ATACTATTTCATCAGTGGAAACAAAGACAACTGCAAAAAAAACGAGAAGCTTGTGGTCATCGTCATGGCTGACAGAAACG
GCAACACCACCACATCATCACCACCACTGCCTTCTCCAGCTCCTGCTCCCTCATCATTACCGCCTTCTCCAGCGTTGGCT
CCCTCGGCAGAGCCCCCTCCTTCTCCACCGCCAATGACAGGACCCTTTGAGACACCAGCACCTACGCCTACTCCAACTCA
CGAAACTCCAAATAGTGCAGCTTCCCCATCTTCTTCCTTTGTGGCTGCTCTTCTTGTAGCTGCCTTTGCTTCCACTCTAT
TCCTACACTAA