Details for Kale Locus Bo5g108460

Position : C5 ( 5`- 33834257 .. 33834745 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g108460

Protein [Map View]
MLNRILLRSSPQQNPKLTTQHHSQLHGSSSYDDVHLSFSSVTYVFIANYTVPRFYQGRKKKAKKWGQVVPLNNQTVLEAV
LPNGLASFRINLKTQVRYKNSFWKTRRFGVDVGAEVGVNGDGVKANKKGIRLKKFDSSSSSSLRSYFPVCVLTNLLVLFA
IC*

DNA
ATGCTCAATCGAATACTTTTACGTTCCAGCCCTCAACAAAACCCTAAACTCACGACTCAACACCACTCTCAACTTCATGG
TTCGTCTAGCTATGACGACGTCCACCTTTCCTTCTCCAGCGTCACCTATGTATTCATCGCTAACTACACGGTGCCAAGAT
TCTACCAGGGACGCAAGAAGAAAGCCAAGAAGTGGGGTCAGGTTGTGCCTCTGAACAACCAGACAGTTTTAGAAGCGGTT
TTGCCTAACGGATTGGCGAGTTTTCGGATAAACCTGAAGACACAAGTGAGGTACAAGAACTCGTTTTGGAAAACTAGGAG
GTTTGGGGTCGACGTTGGTGCTGAAGTTGGAGTCAACGGGGATGGAGTTAAAGCTAATAAGAAAGGGATTAGGTTGAAAA
AATTTGACTCTTCTTCATCTTCTTCATTAAGAAGCTATTTTCCTGTTTGTGTTTTGACGAATCTGCTTGTTTTATTTGCT
ATTTGTTGA