Details for Kale Locus Bo5g108450

Position : C5 ( 5`- 33829082 .. 33830553 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g108450

Protein [Map View]
VSFWSLSDGYQGQQEANKKLVATRAQHRRRVASLTWNKVESNQDVFQDVLSRLSVRSIRSFKTVNRYWHASVSNKHFATI
QLAQSRKKPSYIACPRVDKAMKLYLLKPGKFNYRHHATVDPPGRSADHHMHMIASFNGLVCCINQLSDEHEVDYQIWICN
PSTEETLLLPQGRPSVWTEPSIGVAYGPDISEYKIFRIFCVGKRNAGKGDYLYECEVYSSSTGAWRGIGPVLHLPMYVCF
SPHRSGHVFAGGKIYWLVSLEDPAGIMLSVDMEENFEVMELPYYSTELREEDRITVATYLINLGGSPSLVVLHADYFDVW
EWKEASWVFVIADEFDFMDFAEIVLFMTSSEKEILFVTDSHLWTYHLDTRKWKKRGRPPTRFTNPAIFPFTESLLPCNGG
VRLEGR*

DNA
GTGTCTTTTTGGTCTTTATCTGATGGATACCAAGGGCAACAAGAAGCAAACAAAAAATTGGTCGCGACGCGAGCTCAGCA
TCGCAGGCGAGTGGCATCACTGACATGGAATAAGGTAGAATCCAACCAGGATGTCTTTCAAGACGTCTTATCTCGACTCT
CAGTAAGGTCTATCCGTTCATTCAAAACGGTTAACAGATACTGGCATGCCTCAGTTAGCAACAAACATTTTGCTACGATA
CAGCTCGCTCAATCGAGAAAGAAGCCCTCATACATAGCTTGTCCTAGAGTAGACAAGGCTATGAAGTTGTACTTGTTGAA
GCCAGGGAAGTTCAACTATCGACACCATGCTACAGTTGATCCTCCGGGAAGAAGCGCCGATCACCACATGCACATGATAG
CATCGTTCAATGGATTAGTATGCTGCATCAACCAACTTTCTGATGAACATGAAGTAGATTATCAGATATGGATCTGCAAT
CCTTCTACTGAAGAAACTCTGCTTCTTCCTCAAGGCAGACCATCTGTTTGGACTGAACCAAGTATTGGAGTTGCATATGG
TCCTGACATTAGCGAGTACAAAATTTTCCGCATATTCTGTGTCGGCAAGAGAAACGCTGGAAAAGGGGATTATCTCTACG
AATGTGAGGTGTATTCATCTAGCACTGGTGCATGGAGGGGCATCGGCCCTGTGCTTCATCTTCCAATGTATGTTTGTTTC
AGTCCACACAGATCCGGTCATGTCTTTGCAGGAGGGAAGATCTACTGGCTGGTTTCTCTGGAAGATCCTGCAGGTATAAT
GCTCTCTGTGGATATGGAGGAGAACTTCGAAGTTATGGAGCTGCCTTACTATTCAACAGAGCTGCGTGAAGAAGACAGGA
TAACAGTTGCTACGTATCTGATAAACCTGGGAGGATCTCCGTCACTGGTAGTTCTACATGCGGATTACTTTGACGTATGG
GAGTGGAAAGAAGCTAGTTGGGTATTTGTAATCGCAGATGAGTTTGATTTCATGGACTTTGCTGAAATTGTATTATTCAT
GACCTCGTCAGAGAAGGAGATCCTGTTTGTGACTGACTCGCACTTGTGGACTTATCATTTGGATACTAGAAAGTGGAAAA
AAAGGGGCAGGCCTCCTACTCGATTTACGAATCCTGCTATCTTCCCCTTCACCGAAAGCCTTCTTCCATGCAATGGTGGG
GTGAGGCTAGAAGGAAGGTGA