Details for Kale Locus Bo5g108440

Position : C5 ( 5`- 33819641 .. 33824543 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g108440

Protein [Map View]
MELLRSNLSRVQIPEPTHRIYKHECCLSFDTPRSEGGLFVDMNSFLAFGKDYVAWNHEKTGNPVYLHIKETPKSVPEDRP
LKKPTLLAIGVDGGFDNSETEYEESYSIVILPDFVSLPFPSVELPEKVRIAVDTVLSAVGAERREQVALAAWTADEKKAS
EHALTLQQIKSGVVVPPSGWKCAKCDKKENLWLNLTDGMILCGRKNWDGTGGNNHAVEHYKETSYPLAVKLGTITADLES
ADVYSYPEDDSVLDPLLAQHLAHFGIDFSSLQKTEMTTAERELDQNTNFDWNRIQESGKELVPVFGPGYTGLVNLGNSCY
LAATMQILFSTHSFISRYFSHQSLKLAFEMAPADPTLDLNMQLTKLGHGLLSGKYSIPVTEKDAATAEARQEGIPPRMFK
SVVAAGHGEFSSMRQQDALDFFLHLLDKVERGNNTRPDLDPSRSFKFGVEEKILCSSGKVSYNKRDDCILSLNIPLQEAT
NKDELEAFNNQTAGKGLEENNMSTDEIVRPRVPLEACLATFASPEQIHDYYSTALKGKTTAIKTTGLTSFPDYLVLHMRK
FVMDAGWVPKKLDVYIDVPDVIDISHMRSKGLQPGEELLPDGVPEEVTETAQPVANEEIVAQLVSMGFNQLHCQKAAINT
SNAGVEEATNWLFSHMDDPDIDAPISHQASDVDQSSVDTLISFGFAEEVGRKALKASGGDIEKATDWIFNNPNASVSDMD
VSSSSSAQTPAQTGLPDGGGRYKLFGIVSHMGTSTHCGHYVAHILKEGRWVIFNDSKVGISTDPPKDMGYLYFFQRLDN*

DNA
ATGGAGCTTCTCCGATCGAACTTGTCTAGGGTTCAGATCCCAGAACCCACCCACCGCATCTACAAGCACGAGTGTTGCCT
CTCCTTCGATACCCCGAGATCGGAAGGAGGATTGTTCGTAGACATGAACAGCTTCCTTGCCTTTGGAAAAGACTACGTTG
CTTGGAATCACGAGAAGACGGGGAATCCTGTTTATCTCCACATCAAGGAGACTCCCAAGTCTGTTCCCGAGGATCGCCCT
CTCAAGAAACCTACTCTCCTCGCTATAGGAGTTGATGGCGGATTTGACAACAGTGAGACTGAGTATGAGGAATCTTATAG
CATAGTCATACTTCCCGACTTTGTTTCACTTCCTTTCCCTTCTGTTGAGCTACCAGAGAAGGTGAGGATTGCGGTTGATA
CTGTTCTGAGTGCCGTTGGTGCTGAGCGGAGAGAGCAAGTTGCACTTGCAGCCTGGACTGCTGACGAGAAGAAAGCTAGT
GAACATGCTTTGACGCTGCAGCAGATCAAGAGCGGCGTTGTCGTTCCTCCCTCCGGTTGGAAATGTGCCAAGTGTGATAA
GAAGGAGAATCTCTGGCTTAATCTTACCGACGGGATGATTCTCTGTGGAAGGAAAAACTGGGATGGGACTGGTGGAAACA
ACCATGCTGTTGAGCACTACAAGGAAACAAGCTACCCTCTTGCTGTAAAGCTTGGAACTATCACCGCTGACTTGGAATCA
GCAGATGTGTATTCCTACCCGGAAGATGACAGTGTTTTGGACCCACTCCTGGCTCAGCATCTGGCCCATTTTGGAATCGA
CTTCTCCTCGTTGCAGAAGACAGAAATGACAACTGCCGAAAGAGAACTTGATCAAAATACGAATTTTGATTGGAACCGTA
TACAAGAGAGTGGAAAAGAATTGGTGCCAGTTTTTGGACCTGGATATACTGGACTTGTCAATCTTGGCAACAGTTGCTAC
TTGGCAGCTACGATGCAGATTCTTTTCTCGACCCATTCGTTTATTTCAAGATACTTCTCACATCAGAGCTTAAAGTTGGC
ATTTGAAATGGCTCCTGCTGATCCAACTTTGGACCTCAATATGCAATTGACAAAGCTTGGACATGGTTTACTATCTGGGA
AGTACTCTATTCCTGTAACAGAGAAGGATGCTGCAACTGCAGAAGCTAGGCAAGAAGGAATCCCTCCTCGCATGTTCAAA
TCGGTAGTTGCTGCTGGCCATGGAGAGTTCTCTTCTATGAGACAGCAGGATGCTCTCGACTTTTTCCTCCACTTGCTAGA
TAAAGTTGAGCGTGGCAACAACACGAGACCAGATTTAGACCCCTCGAGGAGCTTCAAGTTTGGAGTAGAAGAAAAGATCC
TGTGTTCATCTGGGAAGGTCTCATATAATAAGAGGGATGACTGTATTCTTTCTTTGAACATTCCACTGCAGGAGGCAACT
AATAAAGATGAATTAGAAGCCTTTAACAACCAGACAGCAGGCAAAGGACTGGAAGAAAATAATATGTCAACTGATGAAAT
TGTACGCCCACGAGTTCCTTTAGAAGCTTGTCTAGCAACGTTTGCATCACCAGAGCAGATTCATGATTACTATAGCACTG
CTCTGAAGGGAAAGACAACAGCTATCAAGACAACTGGTTTGACATCTTTCCCAGATTACTTGGTCTTGCACATGCGGAAG
TTTGTTATGGATGCAGGCTGGGTGCCAAAGAAGCTTGATGTGTACATTGATGTTCCGGATGTAATTGATATCAGCCACAT
GCGCAGCAAAGGGCTTCAACCTGGAGAAGAACTGTTGCCAGATGGCGTTCCAGAAGAAGTGACGGAAACTGCACAGCCTG
TGGCCAATGAGGAGATAGTTGCACAACTCGTCTCAATGGGATTTAACCAGCTTCATTGCCAGAAAGCCGCCATAAATACG
TCTAATGCTGGGGTTGAAGAGGCGACGAACTGGTTATTTTCTCACATGGATGATCCAGATATCGACGCACCAATCTCCCA
TCAGGCATCTGACGTTGACCAATCAAGCGTTGATACCTTAATCTCCTTTGGTTTTGCTGAAGAGGTTGGTCGAAAGGCAC
TCAAAGCCTCGGGAGGAGATATAGAGAAAGCAACAGATTGGATATTCAACAACCCTAATGCATCTGTTTCAGACATGGAC
GTTTCCTCTAGCAGTTCAGCGCAAACTCCAGCTCAGACTGGACTACCAGACGGAGGAGGGAGATATAAGCTGTTTGGGAT
AGTAAGCCACATGGGAACATCAACGCACTGTGGTCACTATGTGGCACACATATTGAAAGAAGGTCGTTGGGTCATATTCA
ATGACAGCAAAGTAGGTATCTCGACAGATCCTCCTAAAGACATGGGTTATCTCTACTTCTTTCAGCGTCTCGACAATTGA