Details for Kale Locus Bo5g107350

Position : C5 ( 5`- 33735553 .. 33738667 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g107350

Protein [Map View]
MLPYVSNVQTEPVVVQIDKLDLVLEENPDDDVTKGPSSAQSPTASGKSNGYGFADRVSYIFHYVDQIADGMTLQVKVVNL
LLETGGGAHREGGCKSERSKGLTSLLTPDLFICLRNLNGKFYQIDLPPHPDMFIDANLARSEEENLRDDDGANQVFFGGE
RFLDGISGQAHQSAEAAGRSLVSVLVDHVFLCIKDAEFQLDLLIQSLLFSRACVLDGESANYLTKILIGGVFLRFIFRKK
LV*

DNA
ATGCTTCCGTATGTCAGCAATGTACAAACGGAGCCTGTAGTTGTGCAAATCGATAAACTCGATCTTGTTCTTGAAGAGAA
TCCTGATGATGATGTGACAAAGGGCCCAAGCAGTGCTCAGTCTCCTACCGCCTCTGGAAAAAGTAACGGTTATGGATTTG
CTGACAGGGTGAGTTATATATTTCATTATGTTGATCAGATTGCAGACGGAATGACTTTACAAGTAAAAGTGGTCAATCTT
CTTCTTGAAACTGGTGGTGGTGCTCACCGTGAAGGAGGTTGTAAATCTGAAAGAAGCAAGGGACTGACTTCTCTACTAAC
ACCGGATTTATTTATTTGTTTAAGAAACTTGAATGGGAAGTTTTATCAAATTGATCTTCCGCCACATCCTGATATGTTCA
TTGACGCTAACTTAGCCCGCTCTGAAGAAGAAAATCTCAGAGATGATGATGGAGCAAACCAAGTTTTCTTTGGCGGTGAA
CGCTTTTTAGATGGAATTTCTGGCCAAGCACATCAGTCTGCTGAAGCAGCAGGAAGGTCTCTTGTCTCTGTTCTTGTGGA
CCATGTGTTTCTTTGCATTAAAGATGCTGAATTCCAACTGGACCTACTGATTCAATCACTCCTCTTCTCTCGAGCCTGTG
TTTTGGATGGAGAATCAGCTAACTATTTGACTAAGATCTTGATTGGTGGAGTATTTTTAAGGTTCATCTTCAGGAAGAAG
CTTGTTTAA