Details for Kale Locus Bo5g107310

Position : C5 ( 5`- 33718936 .. 33721044 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g107310

Protein [Map View]
MVDDRTQDGTQGKGNGDGFAHLGRPDDIDVSIKLRDWLFALEGREGVTERCWHNDNEDIGREERCWHTNFHTFQVIAKST
PKLVDPNVTESNYDAHRYSVDSVNVSQYMAGGVNIEANIVASEDKSGHDDTLNWAAESLKFSVKQPVTVDKGDSFSYPSL
YLKALKLCSYQTIEKQFVLIHGNSVTNGFISNLHLNNSLDIGYHRSALLLFKEMRREPFRANDFTYGSVLKSCKDLGCLK
EGMQIHGCVEKGRFAENLVVRSALLCLYAKCGKMEDARLLFESMKVRDLVSWNIMLDGYTEVSTADTSFSLFQLMLAEGK
KPDCYTFGSLLRACIEVNCLEMVSQLHGFAIKLCFGRSDVALVRSLIVAYAKCGSLGNALKLYDRTMKGDLISCVCQVW*

DNA
ATGGTTGATGACAGGACACAAGATGGAACTCAGGGAAAAGGGAATGGAGATGGTTTTGCACATTTGGGAAGGCCAGATGA
CATTGATGTCTCCATTAAATTAAGAGACTGGTTGTTTGCTTTGGAGGGCAGGGAAGGTGTGACAGAAAGGTGTTGGCATA
ATGATAATGAGGATATTGGTAGAGAAGAAAGGTGTTGGCACACAAATTTCCACACTTTCCAAGTAATAGCCAAGAGTACA
CCAAAGCTTGTGGATCCAAATGTGACAGAAAGCAATTATGATGCTCACAGATATTCTGTAGACTCAGTTAATGTAAGTCA
ATATATGGCTGGAGGGGTAAACATTGAAGCTAACATTGTGGCATCTGAAGACAAATCTGGTCATGATGACACGTTAAACT
GGGCGGCAGAAAGTCTGAAATTCTCTGTTAAACAACCTGTGACAGTTGATAAAGGGGATAGCTTTTCGTACCCTTCCTTG
TACCTCAAGGCTCTCAAATTATGCAGCTACCAAACCATCGAGAAACAGTTTGTGTTGATCCATGGGAACTCTGTGACAAA
TGGGTTCATCTCGAATCTCCACTTGAACAACAGCTTGGATATTGGGTATCACCGGAGCGCGTTGCTGTTGTTCAAAGAGA
TGCGCCGGGAGCCTTTTAGGGCTAATGACTTTACTTACGGGAGTGTTTTGAAGTCGTGCAAAGATTTGGGGTGTCTGAAA
GAAGGGATGCAGATACATGGTTGTGTGGAGAAAGGGAGATTTGCAGAGAACTTGGTTGTGAGGAGTGCGTTGCTTTGTCT
TTATGCTAAGTGTGGTAAAATGGAGGATGCTCGTCTTCTGTTTGAGTCAATGAAAGTAAGAGATTTGGTTTCTTGGAATA
TAATGCTCGATGGATACACTGAAGTTTCTACTGCAGATACCTCGTTTAGTCTGTTCCAGCTGATGCTTGCAGAAGGGAAG
AAGCCAGATTGCTATACCTTTGGGAGCCTCTTGAGAGCTTGTATCGAAGTTAACTGTCTTGAAATGGTCAGTCAATTGCA
CGGTTTTGCCATCAAGCTTTGCTTCGGGAGATCAGATGTTGCACTGGTCAGGTCTCTGATCGTTGCGTATGCCAAGTGTG
GTAGCCTTGGCAATGCTTTGAAACTGTATGACCGCACGATGAAAGGAGACTTGATATCTTGCGTATGCCAAGTGTGGTAG