Details for Kale Locus Bo5g106280

Position : C5 ( 5`- 33663340 .. 33665900 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g106280

Protein [Map View]
MIYRETPQRNASLIILTMMFNEMGMCGNMDFFSPASLGEVDFCPAPTHPEPDSVVDDDYTDDEIDVDELERRMWRDKMRL
KRLKEQDKSGSKEGVDAAKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPENGKPVTGASDNLREWWKD
KVRFDRNGPAAISKYQAENNIPGVREGSNPIGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVPPPWWPNGKE
DWWPQLGLPKDQGPAPYKKPHDLKKAWKVGVLTAVIKHMFPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEESLAR
ELYPESCPPVSLSGGGSCSLLMNDCSQYDVDGLDKETRYEVEELKPEKVNFGMAANFPVKEEVPSEFMRKRKPNRDLNAM
MDRTIFTCENTGCAHGDVSRGFLDRNSRDNHQFVCPHRDSGLPYGAPSRFHVSEVKPVVGFSQPRPVNSVSQPIDLTGIG
VPEDGQKMISELMSMYDRNVQSNQNQTSMVTESQLLQPTVQNHQEHLQFQGNMVEGSFFEDLNIPNRVNNQMFFQGNNNN
SGFKYDTAHTTNNNFEAAHNNASSNRFQLVFDSPPFDMASFDYRDDMSMPGVVGTMDGMQQQKQQDVSIWF*

DNA
ATGATCTACAGAGAGACTCCACAAAGAAACGCAAGTTTAATCATACTCACGATGATGTTTAACGAGATGGGAATGTGCGG
GAACATGGACTTCTTCTCCCCCGCATCTCTCGGGGAAGTTGACTTCTGTCCCGCGCCCACCCACCCCGAACCCGACTCAG
TCGTCGATGACGACTACACCGACGACGAGATCGACGTCGACGAGCTCGAGAGGAGGATGTGGAGGGACAAGATGCGCCTC
AAGCGTCTCAAGGAGCAGGACAAGAGCGGCAGCAAAGAAGGAGTCGACGCAGCCAAGCAGAGGCAGTCTCAGGAGCAAGC
CAGGAGGAAGAAGATGTCCAGAGCTCAAGACGGGATCTTGAAGTACATGCTGAAGATGATGGAGGTCTGTAAAGCTCAGG
GCTTTGTGTACGGTATCATCCCTGAGAACGGGAAGCCTGTCACTGGGGCTTCCGATAATCTCAGGGAGTGGTGGAAAGAT
AAGGTGAGGTTTGATCGGAACGGTCCCGCTGCTATAAGTAAGTACCAAGCGGAGAACAACATCCCTGGGGTTCGTGAAGG
TAGCAACCCCATCGGACCTACTCCGCATACCTTGCAGGAGCTTCAGGACACGACTCTGGGGTCGCTTTTGTCTGCGTTGA
TGCAGCACTGTGATCCTCCTCAGAGACGGTTTCCTTTGGAGAAAGGAGTGCCTCCTCCCTGGTGGCCTAATGGGAAGGAG
GACTGGTGGCCTCAGCTTGGTTTGCCTAAGGATCAAGGCCCTGCTCCTTACAAGAAGCCTCATGATCTGAAGAAGGCGTG
GAAGGTCGGCGTGTTGACTGCTGTTATCAAGCATATGTTTCCTGATATTGCGAAGATCAGGAAGCTCGTGAGGCAGTCCA
AGTGCTTGCAGGATAAGATGACTGCTAAGGAGAGTGCTACGTGGCTTGCTATTATTAACCAGGAAGAGTCCTTGGCTAGG
GAGCTTTACCCTGAGTCCTGCCCTCCTGTTTCTTTGTCCGGTGGTGGAAGCTGCTCGCTTCTGATGAATGATTGTAGTCA
GTACGACGTTGATGGTTTGGATAAGGAGACTCGCTATGAAGTGGAGGAGCTCAAGCCGGAGAAAGTTAACTTTGGGATGG
CTGCTAACTTCCCTGTGAAGGAAGAAGTTCCATCAGAGTTCATGAGGAAGAGGAAGCCAAACAGAGATCTCAACGCTATG
ATGGACAGAACCATCTTCACCTGCGAGAACACTGGGTGTGCGCATGGCGATGTCAGCCGTGGTTTTCTTGATAGGAACTC
AAGAGACAACCATCAGTTTGTTTGTCCACATCGAGACAGCGGCTTACCCTATGGAGCACCGTCCAGGTTCCATGTCAGTG
AAGTTAAGCCTGTGGTTGGATTCTCTCAGCCAAGGCCAGTGAACTCGGTTTCTCAGCCAATTGACTTAACCGGTATTGGA
GTTCCTGAAGATGGGCAGAAGATGATCTCCGAGCTCATGTCCATGTACGACAGAAACGTCCAGAGCAACCAAAACCAGAC
TTCTATGGTCACGGAAAGTCAACTGCTTCAACCAACGGTCCAGAATCACCAAGAACATCTCCAGTTTCAAGGAAACATGG
TGGAAGGAAGTTTTTTTGAAGACTTGAACATTCCAAACAGAGTTAACAACCAAATGTTCTTTCAAGGGAACAACAACAAC
AGTGGGTTCAAGTACGATACTGCGCACACCACCAACAACAACTTTGAAGCTGCGCATAACAACGCTAGCAGCAACAGGTT
TCAGCTTGTGTTTGATTCTCCACCGTTTGATATGGCCTCATTCGATTACAGAGATGATATGTCGATGCCGGGAGTAGTGG
GAACGATGGATGGTATGCAGCAGCAGAAGCAGCAAGATGTATCCATATGGTTCTAA