Details for Kale Locus Bo5g106270

Position : C5 ( 5`- 33652675 .. 33656979 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g106270

Protein [Map View]
MAGGDSPAETKKGSSKTSKNSKESTLKQKSPAEFFAENKNIAGFDNPGKSLYTTVRELVENALDSSESISELPEVEVTMY
VVFPSFTHLSGYVKSISFFLSLTVLFSFESEEIGKSKFNSMIGLIDRERVDTKLYDDYETDKAREKRLVKEARASEIQAK
NLASGKKNKEPGVSKVLKARGEASYYKVTCKDNGKGMPHDDIPNMFGRVLSGTKYGLKQTRGKFGLGAKMALIWSKMSTG
LPIEISSSMKSQNYVTFCRLDIDIHRNIPHIHLHEKKANKEKWHGAEIQVVIEGNWTTYRSKILHYMRQMAVITPYAQFL
FRFISETPEKNVTVKFTRRTDVMPPIPIETKHHPSSVDLLLIKRLVTDTSKKTLLQFLQNEFVNINKKLAARLIGEMGPD
FSPGMAVKSVTSQQMVRIHQLFRQAKFDDPSGDCLSPAGEYNLRLGIIKELHPDMVATHSGSAQVFEGHPFIVEAGVSVG
GRDVKQGINIFRFANRIPLLFEQGGDVVTRTALKRINWNSYKINQTQDKIGVFVSIVSTKIPFKGTGKEYIGDDISEIAT
AVKSAIQQCCIQLKSKIVKRLQAREQQERKRSLSRYIPDATGAVYEVLKQMTEEHTKKRKRYKEEETAMLEKVSKLIITK
ETLKEKLAEHVEQVDYEMALEYATQSGVSEEPRENIHLQQLNPNHSNFIDLHSPTFVFRLIL*

DNA
ATGGCGGGAGGTGATAGTCCAGCTGAAACGAAGAAGGGAAGCTCCAAGACCTCTAAGAACAGTAAAGAGAGCACTCTCAA
GCAGAAATCTCCAGCTGAGTTTTTCGCCGAGAACAAGAACATTGCTGGATTCGATAATCCAGGGAAGTCGCTGTACACTA
CAGTGAGAGAGCTTGTTGAAAATGCTCTTGATTCTTCTGAGTCCATCTCTGAGCTCCCTGAGGTTGAAGTTACTATGTAC
GTTGTCTTCCCTTCATTTACCCATCTATCAGGATATGTAAAATCTATATCTTTCTTCCTTTCATTGACTGTCTTGTTCTC
TTTTGAAAGCGAAGAGATTGGAAAATCTAAGTTCAATTCCATGATTGGTCTCATTGATCGGGAACGTGTTGACACCAAGC
TCTATGATGACTATGAGACTGACAAGGCCCGTGAGAAAAGGTTAGTAAAGGAAGCTCGTGCCAGCGAGATACAAGCCAAA
AATTTGGCTTCAGGAAAGAAAAACAAAGAGCCTGGAGTCTCTAAGGTTTTAAAGGCCCGTGGGGAAGCATCCTATTACAA
GGTTACATGTAAGGATAATGGTAAGGGGATGCCACACGATGACATCCCGAATATGTTTGGCAGAGTTCTGTCTGGGACCA
AGTATGGACTGAAGCAAACTCGTGGAAAGTTTGGTTTAGGGGCAAAGATGGCTTTAATTTGGTCCAAAATGAGTACAGGC
CTCCCCATAGAGATATCTTCATCTATGAAGAGCCAAAACTATGTTACGTTCTGCAGATTGGATATTGATATTCACAGGAA
CATCCCTCACATTCATCTACACGAGAAGAAGGCCAACAAAGAGAAATGGCATGGGGCCGAAATACAGGTGGTAATTGAGG
GAAACTGGACAACATACAGATCAAAGATCTTGCACTACATGCGCCAAATGGCTGTTATCACTCCTTATGCCCAGTTTCTA
TTTAGATTTATTTCAGAAACACCCGAGAAAAATGTCACTGTAAAATTTACTCGAAGAACGGATGTGATGCCCCCAATTCC
TATCGAGACAAAGCACCATCCTTCGTCAGTTGACTTGCTGCTTATCAAGCGCCTTGTTACAGACACTTCCAAAAAGACCC
TTCTGCAGTTTCTTCAGAATGAATTTGTGAATATTAACAAAAAACTTGCAGCGCGATTAATTGGGGAAATGGGACCCGAT
TTCAGCCCTGGCATGGCTGTCAAGTCTGTGACATCTCAGCAAATGGTGCGCATACATCAGTTATTCCGCCAAGCTAAATT
CGACGACCCTAGTGGTGATTGTCTTAGCCCGGCAGGAGAATACAATCTTCGTCTAGGGATTATCAAGGAGCTGCATCCAG
ATATGGTGGCAACGCATTCAGGCAGTGCTCAGGTCTTTGAAGGTCATCCTTTTATTGTTGAAGCTGGTGTTAGTGTGGGT
GGAAGAGATGTGAAACAGGGGATAAACATATTCCGTTTTGCAAACCGTATTCCTCTCCTTTTTGAACAAGGAGGTGATGT
TGTGACCAGAACAGCCTTAAAGAGAATCAATTGGAATAGCTATAAGATTAACCAAACGCAAGATAAAATAGGAGTATTTG
TGAGCATAGTGAGTACAAAAATTCCTTTCAAAGGGACAGGGAAAGAATACATAGGAGACGACATCAGTGAGATAGCTACT
GCAGTCAAGTCTGCAATTCAACAATGCTGCATCCAACTGAAATCCAAAATAGTCAAGAGACTTCAAGCACGCGAACAACA
AGAGAGAAAACGCAGTTTGAGCAGGTACATCCCTGATGCAACGGGAGCGGTGTACGAGGTCCTAAAACAAATGACTGAAG
AACATACGAAAAAGAGAAAGCGTTACAAAGAGGAAGAAACCGCTATGCTTGAGAAAGTGTCTAAACTTATAATCACAAAA
GAAACATTGAAAGAAAAGCTTGCTGAGCATGTGGAACAGGTGGATTACGAGATGGCATTAGAGTATGCAACACAGAGTGG
AGTGAGTGAAGAACCCAGAGAAAATATACATCTCCAACAATTGAATCCCAACCATTCCAACTTCATTGATCTTCACAGTC
CGACCTTTGTCTTCAGGCTCATCTTGTAA