Details for Kale Locus Bo5g106260

Position : C5 ( 5`- 33649762 .. 33652309 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g106260

Protein [Map View]
MANPSPPGIAILGAGIFVKTQYIPRLAEISDLVNLKAIWSRSEESAKGAVEVARKHFPGVECKWGDEGLNEIIQDTSILG
VAVVIAGQTQVEMSLKMLKAGKHVLQEKPAAASIGEIETAMTSYKNISTDSPCRPIWAVAENYRFEPAFVELKKLVEEIG
DMMNVQLIIEGSMNSSNPYFSSSWRRNLDGGFILDMGVHYIAGLRMLVGCEVTSVSATTSHVDKTLPAPDNITSNFQLEN
GCSGVFVMVVSSRSPKILWRVVGLKGTVQLERGVQDGRHGYMATVYGEGGTSRTIFYPFSGVTEELKAFFRDISGTSKEQ
EPRLSYVEGARDVAVLEAMLESGARNGAVIPVKKF*

DNA
ATGGCGAATCCTTCACCACCTGGAATTGCTATTCTCGGAGCTGGGATCTTCGTCAAGACGCAGTACATTCCTCGGTTAGC
TGAGATCTCCGATCTCGTCAACCTCAAAGCCATTTGGAGCCGTTCTGAGGAATCTGCGAAAGGAGCTGTGGAGGTAGCAC
GAAAGCATTTTCCTGGAGTGGAGTGCAAATGGGGAGATGAAGGTCTGAATGAGATCATTCAAGACACTTCCATACTTGGT
GTTGCTGTTGTCATTGCTGGCCAAACCCAGGTTGAAATGTCGCTAAAGATGCTCAAGGCAGGAAAGCACGTCCTTCAAGA
GAAGCCAGCTGCTGCTTCAATCGGTGAGATTGAAACTGCAATGACAAGCTATAAAAATATTTCTACTGATTCCCCATGCC
GTCCAATCTGGGCTGTGGCTGAAAATTATCGTTTTGAACCAGCTTTTGTTGAGTTGAAGAAACTAGTGGAAGAAATTGGG
GATATGATGAACGTCCAACTTATTATCGAGGGATCAATGAACAGTTCCAATCCTTACTTCTCAAGCTCCTGGAGACGAAA
CTTGGACGGTGGTTTCATCTTGGATATGGGTGTGCACTACATTGCAGGGTTAAGAATGCTTGTTGGATGTGAGGTAACAT
CAGTCTCAGCCACCACCTCACATGTTGATAAGACTTTACCTGCACCAGACAACATTACATCAAACTTTCAGCTAGAGAAC
GGATGCTCTGGAGTCTTTGTGATGGTTGTCTCTTCAAGGTCTCCAAAGATATTATGGAGAGTCGTAGGATTAAAGGGCAC
TGTTCAACTTGAGCGTGGAGTTCAAGATGGCCGACATGGTTACATGGCCACAGTTTACGGGGAAGGAGGGACATCGAGGA
CCATCTTTTACCCGTTCAGTGGAGTGACTGAAGAGCTAAAAGCATTCTTCAGGGACATTTCAGGAACTTCAAAGGAGCAA
GAGCCTCGTCTATCATACGTGGAAGGTGCTCGGGACGTTGCTGTTCTTGAAGCAATGCTTGAATCTGGTGCAAGGAACGG
AGCTGTTATTCCCGTTAAAAAGTTCTAG