Details for Kale Locus Bo5g106250

Position : C5 ( 5`- 33647324 .. 33649375 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g106250

Protein [Map View]
TQNRTEQRRNRTLQTREKGGKVQVNLRESERQIIESGGRMANLPPSLSMGTPFGGPSTSVGAPANKDRNLASAEQLVLDL
SNPELRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYSVLAPPNLTPAQSNRVCNSLALLQCVASHSDTRML
FLKAHIPLYLYPFLNTTSKSRPFEYLRLTSLGVIGALVKVDDTEVISFLLSTEIIPLCLRTMEMGSELSKTVATFIVQKI
LLDDVGMDYICTTAERFFAVGRVLGNMVQSLVEQPSPRLLKHIIRCYLRLSDNPRACAALGSCLPDSLRDGTFSNCLRED
QIARRWLQQLVHNVGVGRVPSHQGGGFEHML*

DNA
ACACAGAACAGAACAGAACAGAGGAGAAACCGAACTCTTCAAACTCGAGAGAAAGGAGGAAAGGTGCAAGTAAACCTACG
AGAAAGCGAGAGACAGATAATCGAATCTGGTGGAAGAATGGCGAATCTACCTCCATCTCTCTCCATGGGCACACCTTTCG
GCGGTCCCAGCACGTCGGTCGGAGCTCCGGCGAACAAAGATCGAAACTTGGCCTCCGCGGAGCAGTTGGTTCTCGATCTC
AGCAATCCTGAACTCAGAGAGAATGCTCTCCTCGAGCTTTCCAAGAAAAGAGAACTGTTTCAGGATTTGGCGCCTCTCTT
GTGGAACTCTTTTGGTACCATTGCTGCCTTGTTGCAGGAGATAGTGTCAATCTACTCTGTTCTTGCTCCTCCTAATCTGA
CTCCTGCTCAGTCCAACCGTGTCTGCAACTCACTCGCCCTTCTTCAGTGCGTAGCCTCTCATTCCGACACAAGGATGTTA
TTTTTGAAGGCTCACATTCCGTTGTACCTTTACCCCTTCCTGAACACAACGAGTAAGTCAAGACCTTTCGAGTACTTGCG
CCTTACTAGCTTAGGTGTCATTGGTGCTCTTGTTAAGGTTGATGATACAGAGGTCATTAGCTTCCTTCTATCAACCGAAA
TTATTCCTCTGTGCCTCCGCACCATGGAGATGGGGAGCGAGCTGTCGAAAACTGTTGCCACATTCATAGTTCAGAAGATC
TTGTTGGATGATGTGGGGATGGATTACATCTGCACAACAGCAGAGCGTTTTTTCGCTGTTGGTCGAGTGTTGGGAAACAT
GGTTCAGTCACTTGTTGAGCAGCCTTCTCCACGTCTTTTGAAGCATATCATCCGTTGTTACCTCCGTTTATCAGACAACC
CTAGGGCGTGTGCTGCACTCGGAAGCTGTCTCCCTGACTCGCTGCGAGATGGAACCTTCAGCAATTGTCTTCGCGAGGAT
CAAATCGCGAGGAGGTGGCTGCAACAGCTGGTTCACAATGTTGGAGTTGGTCGAGTCCCATCACATCAAGGTGGAGGATT
TGAGCACATGCTTTGA