Details for Kale Locus Bo5g106210

Position : C5 ( 5`- 33593158 .. 33595113 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g106210

Protein [Map View]
MSGAPTAASSGNHSLHLPTPTLDAESQSLLQSISAQGGYAYARMAALAVAGDQSAAEAARDMAWEQLHSGPWHSVLPVWR
DAYSMACLHVAKFHFAAGEFGEALGALDMGLIMGGTLLRKDLHDSVLLVSSEARKMAKSLGDFKGEKLVPEVPVDVNEVL
KILPLRSLTSGRVEKRCDLSMEGFLRDYFQTGTPVVITNCMAHWPARTKWNHLDYLTSVAGNRTVPVEVGKNYLCSDWKQ
ELVTFSKFLERMRTNRSTSVEPTYLAQHPLFDQINELRDDICIPDYCFVGGGDLQSLNAWFGPAGTVTPLHHDPHHNILA
QVVGKKYVRLYPSSLQDELYPYSETMLCNSSQVDLDNIDKNEFPKAVELEFMDCILEEGEMLYIPPKWWHYVRSLTMSFS
VSFWWSNEAESSDS*

DNA
ATGTCAGGAGCTCCCACCGCCGCTTCCTCCGGAAACCACAGCCTCCATCTCCCGACTCCAACCCTCGACGCGGAGTCGCA
ATCCCTGCTGCAGTCGATCTCCGCTCAAGGCGGTTACGCCTATGCTCGCATGGCGGCGCTAGCAGTCGCCGGCGACCAAA
GCGCGGCGGAGGCGGCGCGTGATATGGCCTGGGAGCAGCTTCACTCCGGTCCCTGGCACTCTGTTCTCCCCGTCTGGCGC
GACGCTTACTCGATGGCTTGTCTCCACGTCGCCAAGTTCCATTTCGCCGCCGGCGAGTTTGGGGAAGCTCTCGGCGCGCT
CGATATGGGTCTCATCATGGGAGGGACGCTTCTCCGCAAGGACCTCCACGACTCTGTGCTCTTGGTCTCCTCTGAAGCTC
GTAAGATGGCTAAGAGCCTCGGAGATTTCAAGGGTGAGAAGTTGGTCCCTGAAGTTCCCGTCGATGTCAATGAGGTGCTA
AAGATTCTACCTTTGAGGTCATTGACTAGTGGAAGGGTAGAGAAGAGGTGTGATTTATCTATGGAGGGGTTTCTTCGTGA
TTATTTTCAGACAGGTACACCTGTTGTTATAACCAATTGTATGGCTCATTGGCCAGCTAGGACCAAGTGGAACCACTTGG
ACTATCTCACTTCTGTTGCTGGTAACCGTACCGTTCCCGTCGAGGTGGGGAAAAACTATTTGTGTTCAGATTGGAAGCAA
GAGCTTGTGACTTTTTCCAAGTTCCTTGAACGGATGAGGACCAATAGATCCACCTCCGTGGAACCTACTTATCTTGCTCA
GCATCCGTTGTTTGATCAGATAAATGAACTGAGAGATGATATATGTATTCCTGATTACTGTTTTGTCGGTGGAGGGGATC
TCCAATCCCTTAATGCTTGGTTTGGTCCGGCTGGGACAGTTACTCCTTTACACCATGATCCACATCATAATATACTTGCT
CAGGTTGTTGGCAAGAAGTATGTAAGGCTTTACCCATCCTCGTTGCAAGACGAACTTTACCCTTATTCTGAGACAATGCT
TTGCAACTCTAGCCAGGTTGATCTTGACAACATCGACAAGAACGAGTTTCCAAAGGCGGTGGAGCTAGAGTTTATGGATT
GTATCCTAGAGGAAGGAGAAATGCTGTACATCCCTCCCAAATGGTGGCACTATGTCAGGTCTTTAACAATGAGTTTCTCG
GTTAGCTTCTGGTGGAGCAATGAAGCAGAGTCCTCTGATTCTTAG