Details for Kale Locus Bo5g106200

Position : C5 ( 5`- 33581941 .. 33583038 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g106200

Protein [Map View]
MKLNVFVLLLLLLVSTATCCPPSDRRALLAFRAALHEPYLGIFNSWTGQDCCHNWYGVSCDSLTHRVADINLRGESEDPI
FERAHRTGYMTGHIAPAICDLTRLSAITIADWKGISGEIPTCITRLPFLRTLDLIGNQISGGIPNDIGRLHRLAVLNVAD
NRISGSIPKSLTNLSSLMHLDLRNNLISGVIPPDFGRLTMLSRALLSGNRITGRIPESLTRIYRLADVDLSGNQLYGPIP
PSLGRMAVLATLNLDGNKFSGEIPQTLMTSSVMNLNLSRNMLQGKIPEGFGPRSYFTVLDLSYNNLKGPIPRSISGASFI
GHLDLSHNHLCGRIPVGSPFSHLEAASFMYNDCLCGKPLRACLKN*

DNA
ATGAAGCTCAACGTCTTCGTATTACTCCTCCTCCTTCTAGTCTCAACCGCAACATGCTGTCCGCCTTCAGACCGCCGTGC
ACTTCTAGCTTTCCGTGCAGCACTCCACGAGCCATACCTCGGCATTTTCAACTCATGGACCGGTCAAGATTGCTGCCACA
ACTGGTACGGCGTTAGCTGCGACTCGCTCACTCACCGAGTCGCCGACATCAACCTCCGCGGCGAGTCAGAAGACCCCATC
TTCGAGCGAGCTCACCGAACCGGTTACATGACCGGACACATCGCTCCGGCGATATGCGACCTCACGCGTCTCTCCGCCAT
CACCATCGCCGATTGGAAAGGTATCTCCGGTGAGATTCCCACATGCATCACACGTCTCCCTTTCCTCCGTACGCTCGATC
TCATCGGAAACCAAATCTCCGGCGGGATACCAAACGACATCGGAAGGCTACACCGGTTAGCTGTTTTAAACGTAGCGGAT
AACCGGATATCCGGTTCAATTCCAAAATCGTTAACCAACCTCTCTAGCTTAATGCATTTAGACCTCCGTAACAACCTCAT
CTCCGGCGTAATCCCGCCGGACTTCGGCCGGTTAACCATGCTCAGCCGCGCATTGCTAAGCGGGAACCGGATAACCGGTC
GAATTCCCGAATCACTAACCCGGATTTACCGGTTAGCGGACGTTGATCTCTCCGGTAACCAACTATACGGCCCGATCCCA
CCGTCTCTAGGCCGTATGGCGGTTCTCGCGACGCTAAACCTCGACGGAAACAAATTCTCCGGTGAGATACCACAAACTCT
GATGACGTCATCGGTGATGAACTTGAATTTGAGCAGGAACATGTTGCAAGGGAAGATACCGGAAGGGTTCGGACCAAGGT
CTTACTTCACTGTACTTGATTTGTCTTATAACAATCTCAAGGGACCAATCCCGAGATCAATTTCTGGTGCGTCGTTTATT
GGTCATTTGGATCTTAGCCATAACCATCTCTGCGGGAGGATTCCGGTGGGGTCGCCGTTCAGTCACCTTGAAGCGGCGTC
GTTTATGTACAACGACTGTCTTTGCGGCAAACCTTTGAGGGCTTGTTTAAAAAACTGA