Details for Kale Locus Bo5g106190

Position : C5 ( 5`- 33564120 .. 33565325 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g106190

Protein [Map View]
MESSPSSPPSSPEILNLDSIRALKILGQGATGTVFLAHDVVSVSSSSFAVKLVHKSSASSLRRARWEIEVLRRLSVQTNQ
NPFLPRLLASFESPEYFVWAVPYCSGGDLNVLLRRQNDGVFSSSVIRFYVAEIVCALEHLHSMGIAYRDLKPENILIQQS
GHVTLTDFDLSQSLKKPTRPEFFQPDPELCTDPKKSRSFSRWVSPAASESKKTRSARVNPITRRKTSFSSGERSNSFVGT
DEYVSPEVIRCDGHDFAVDWWALGVLTYEMMYGETPFKGKSKKETFRNVLVKEPEFAGKPNDLTDLIRRLLVKDSSRRLG
SRRGAAEIKEHPFFAGVRWDLLTEVLRPPFIPLRDDGELTAGGFDIREHLEKLRMTVSSAPPSPFQSPSHVCRNSDSFID
F*

DNA
ATGGAGTCATCGCCGTCGTCCCCACCTTCATCGCCGGAGATTCTCAACCTCGATTCTATCAGAGCTCTCAAAATCCTCGG
ACAAGGCGCCACCGGAACTGTCTTCCTCGCACACGACGTTGTTTCTGTCTCCTCTTCTTCCTTCGCCGTCAAGCTTGTCC
ACAAATCGTCAGCCTCCTCTCTCCGCCGTGCACGGTGGGAAATCGAGGTCCTCCGTCGTCTCTCCGTTCAAACGAATCAA
AACCCTTTTCTCCCTCGTCTCTTAGCTTCCTTCGAGTCACCGGAATATTTCGTATGGGCTGTCCCGTATTGCTCCGGCGG
CGATCTCAACGTCCTCCTTCGCCGTCAAAACGACGGCGTTTTCAGCTCCTCTGTTATTAGATTCTACGTGGCTGAGATCG
TCTGTGCGCTTGAGCATCTTCATTCCATGGGGATCGCTTACAGAGACTTGAAACCTGAGAACATTCTCATTCAGCAATCC
GGTCACGTTACACTCACCGACTTCGACCTTTCTCAGAGCCTCAAGAAGCCCACCCGACCCGAATTCTTTCAACCCGACCC
GGAATTGTGCACCGATCCTAAAAAAAGTCGGAGCTTTTCTCGCTGGGTCTCTCCGGCGGCGTCGGAGAGCAAGAAAACGA
GATCCGCTCGGGTTAACCCGATTACTCGCCGGAAAACCAGTTTTTCCTCCGGCGAACGTTCAAATTCCTTCGTCGGAACT
GATGAGTACGTCTCGCCGGAGGTAATTCGCTGCGACGGTCACGACTTCGCCGTCGATTGGTGGGCTCTCGGTGTTCTGAC
ATACGAGATGATGTACGGAGAGACTCCGTTCAAAGGGAAGAGCAAGAAGGAGACTTTTCGAAATGTGCTGGTTAAAGAAC
CTGAGTTCGCCGGGAAACCAAATGATCTCACGGATCTTATCCGGCGGCTGCTTGTGAAAGACTCGAGTAGGCGGTTAGGT
AGCCGCCGTGGCGCAGCGGAGATAAAGGAGCATCCTTTTTTCGCGGGTGTGAGGTGGGATTTGTTAACGGAAGTGTTACG
ACCTCCGTTTATTCCGTTGAGAGATGACGGGGAATTAACGGCTGGTGGGTTCGATATAAGGGAACATTTGGAGAAACTGA
GGATGACGGTGTCATCAGCTCCTCCGTCACCGTTTCAGTCTCCTTCGCACGTGTGTCGTAACAGCGATTCGTTCATTGAC
TTCTGA