Details for Kale Locus Bo5g105180

Position : C5 ( 5`- 33530563 .. 33533176 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g105180

Protein [Map View]
MNSNNWLGFPLSLNHSSLPPHEYNIGLVSDHMDNPFQTQEWNMINPHGGGGEVPKVADFLGVSKPDENQPDHIVAYNDPG
YYFHTTNSLMPNVQSNDVVVACDSNNPNDSYELQESAHNLQSLTLSMGTTGGSNAVAKALPPEVTGDNTSGGALAVAETA
TPRRALDTFGQRTSIYRGVTRHRWTGRYEAHLWDNTCRREGQSRKGRQGGYDKEDKAARSYDLAALKYWGPSTTTNFPIT
NYEKELEEMKHMTRQEFVAAIRRHHQHGRWQARIGRVAGNKDLYLGTFSTEEEAAEAYDIAAIKFRGLNAVTNFEMNRYD
VKAILESSTLPIGGGAAKRLKEPQALESSRKREAEMIALGSSFQYGSGSSSSRLQLQPYPLSIQQPLEPFLSLQNNDISH
YNTNAHDASSFNHNSYIQTQLHLHQQTNNYLQQQSGQNSQQLYNAYLQSNPDLLHGVVSTSIVDNNNNGGSSGSYNTAAF
LGHHGIGVGTSSTVGSTGEFPAVKTDYDMASSDGNGGYGGWTGESVQGSNPGGVFTMWNE*

DNA
ATGAATTCAAACAACTGGCTTGGCTTTCCACTTTCACTAAACCACTCTTCTTTGCCTCCTCATGAATATAACATTGGCTT
GGTGAGCGACCATATGGACAACCCTTTCCAAACACAAGAGTGGAACATGATCAATCCACACGGTGGAGGAGGAGAGGTTC
CAAAAGTGGCAGACTTTCTCGGTGTGAGCAAACCGGACGAAAATCAACCCGACCACATCGTAGCTTACAACGACCCAGGT
TACTACTTCCATACCACCAATAGCTTGATGCCTAACGTCCAATCAAACGACGTCGTTGTAGCTTGTGACTCCAACAATCC
TAACGATAGCTATGAGCTCCAAGAGAGTGCTCACAATCTACAGTCACTCACTTTGTCCATGGGGACGACCGGTGGTAGTA
ACGCTGTAGCTAAAGCGTTGCCGCCCGAGGTCACCGGCGATAACACTAGCGGTGGAGCATTAGCCGTTGCTGAGACGGCC
ACGCCAAGACGTGCTTTGGACACTTTCGGACAACGCACCTCGATCTATCGTGGTGTCACAAGGCATCGATGGACCGGTCG
ATATGAAGCTCACCTGTGGGATAATACTTGTAGAAGGGAAGGTCAGTCTAGGAAAGGAAGACAAGGTGGGTATGACAAAG
AAGATAAAGCAGCAAGATCATATGATCTAGCCGCACTTAAGTACTGGGGTCCCTCGACTACTACTAATTTCCCGATTACT
AACTACGAGAAAGAATTAGAAGAAATGAAGCACATGACTAGACAAGAGTTCGTGGCTGCTATTAGAAGGCATCACCAACA
TGGAAGATGGCAAGCACGGATCGGACGAGTCGCCGGAAACAAAGATCTCTACTTGGGAACTTTTAGCACTGAGGAAGAAG
CAGCAGAAGCTTATGATATAGCCGCGATAAAGTTCAGAGGGCTCAACGCAGTGACCAACTTCGAGATGAACCGGTACGAC
GTGAAAGCCATCCTCGAGAGCAGTACTCTCCCCATAGGAGGAGGCGCGGCTAAGCGGCTCAAAGAACCTCAGGCTCTTGA
GTCTTCAAGGAAACGCGAGGCTGAGATGATAGCCCTTGGTTCAAGTTTCCAATATGGTAGCGGCTCGAGCTCATCAAGGC
TTCAGCTTCAACCTTACCCTCTAAGCATTCAACAACCATTAGAGCCTTTTCTTTCTCTACAGAACAATGATATCTCTCAC
TACAATACCAATGCTCATGACGCGTCCTCCTTTAACCATAATAGCTATATCCAAACACAGCTTCATCTTCACCAACAAAC
CAACAATTATTTGCAGCAACAATCGGGTCAGAACTCGCAGCAGCTCTATAATGCGTATCTTCAAAGCAATCCGGATCTGC
TTCATGGCGTTGTCTCCACCTCTATCGTTGACAACAACAACAATGGAGGCTCTAGTGGGAGCTACAACACTGCAGCTTTT
CTTGGGCACCACGGCATTGGTGTTGGGACGAGCTCGACCGTTGGATCGACCGGGGAGTTTCCAGCTGTTAAAACAGACTA
CGATATGGCTTCGAGTGATGGCAATGGAGGGTATGGTGGTTGGACCGGTGAGTCTGTTCAGGGGTCGAATCCTGGTGGTG
TTTTCACTATGTGGAATGAGTGA