Details for Kale Locus Bo5g105150

Position : C5 ( 5`- 33519428 .. 33522178 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g105150

Protein [Map View]
MDSQMLVALGLSLVGGLSTSLGALFVVLSETPNMKMLGLLQGFAAGLMLSISFLDLAHNAINSIGFLKGNLWFFGGVIFF
ACIAKFIPEPTLGPSTDVKRRKKNGDEGGKDMAKKHRRQVLYSGIVTAIGISLHNFPEGMAVFLGSIKGMRVGVNLALAI
ALHNIPEGVAVALPIYFATESKWQAFKLATLSGLAEPLGVIIVAYLFPSSLSPEILEGLLGAVGGIMAFLTLHEMLPLAF
DYAGQKQAVKAVFVGMACMSASLYFLELSLPESMG*

DNA
ATGGATTCGCAGATGCTCGTGGCGCTTGGACTGTCCCTTGTGGGTGGATTAAGTACTTCTTTAGGTGCGCTTTTCGTAGT
TCTCAGTGAGACTCCCAATATGAAGATGCTTGGACTTCTGCAGGGTTTTGCGGCAGGTCTGATGTTGAGCATATCGTTCC
TGGATTTGGCTCATAATGCTATAAACTCTATTGGCTTCTTGAAAGGCAATCTCTGGTTTTTCGGTGGTGTGATATTCTTT
GCGTGTATTGCCAAATTCATACCGGAACCAACACTTGGTCCTTCTACTGACGTGAAAAGAAGAAAGAAGAATGGAGACGA
GGGAGGTAAGGACATGGCAAAGAAGCATCGACGGCAAGTGTTATATAGTGGAATTGTTACAGCTATTGGAATAAGCTTGC
ACAATTTTCCAGAGGGGATGGCCGTATTTCTCGGATCAATTAAGGGCATGCGAGTTGGTGTTAATCTGGCTTTGGCAATC
GCTTTACACAACATTCCTGAGGGTGTGGCGGTTGCACTTCCTATATACTTTGCAACAGAGAGCAAATGGCAGGCATTCAA
ATTGGCAACACTCTCTGGTTTAGCTGAGCCTCTAGGTGTAATTATCGTGGCTTATCTATTCCCGAGCAGCTTGAGTCCTG
AAATCCTTGAAGGCTTGTTGGGAGCAGTTGGTGGAATCATGGCTTTCCTAACTTTGCACGAAATGCTTCCTTTGGCATTT
GATTATGCTGGACAGAAGCAAGCTGTAAAGGCTGTGTTTGTCGGTATGGCTTGTATGTCTGCAAGTCTTTACTTTCTGGA
GCTGAGTTTACCTGAGTCAATGGGTTAG