Details for Kale Locus Bo5g105140

Position : C5 ( 5`- 33512503 .. 33514593 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g105140

Protein [Map View]
MSDPACIFNNGIVDGYDYSFNYSTSLSHIYNSNGSFYYPHNTTDINPNSTLPESPPLREALPLLSLSPIHKQQEDIVPQH
EYCFMETTENSSNSNFLNHNLDQCQESTHHYDVTVDLHLGLPNPGGDAIGYGGGGSSSSDVILDSTDQEHHQDRHQYHGV
EVTLASDHHHDGHGGVQRGSHNHYWIPTPSQILMGPTQFSCPLCYKTFNRYNNMQMHMWGHGSEYRKGPESLRGTQPTGM
LKLPCYCCAPGCKNNIEHPRARPLKDFRTLQTHYKRKHGARPFACRRCGKAFAVKGDWRTHEKNCGRLWYCSCGSDFKHK
RSLKDHVKAFGNGHVPCFGIDCFGDHEDEEAASDVEQQE*

DNA
ATGTCTGATCCAGCTTGTATTTTCAACAATGGCATTGTCGACGGCTATGACTATAGCTTCAACTATTCCACTTCTCTCTC
ACACATCTACAACTCTAATGGCAGCTTCTATTACCCTCACAATACCACAGACATAAACCCTAATTCTACTTTACCTGAAT
CTCCTCCACTTAGAGAAGCTCTTCCTCTCCTTAGCTTAAGCCCCATCCATAAGCAGCAAGAAGATATTGTTCCTCAGCAT
GAATACTGTTTCATGGAGACGACCGAAAACTCTTCTAATTCAAACTTTCTTAATCATAATCTTGATCAATGCCAAGAAAG
TACTCATCATTATGATGTGACCGTGGATCTTCATCTAGGGTTGCCAAACCCCGGTGGCGACGCTATTGGTTACGGGGGTG
GTGGGAGCAGCAGCAGCGATGTCATCCTTGATTCTACCGACCAAGAGCATCATCAAGATCGTCATCAATATCATGGAGTA
GAAGTTACACTTGCTTCTGATCATCATCATGATGGTCATGGTGGTGTACAAAGGGGTAGTCATAATCACTATTGGATCCC
TACTCCTTCTCAGATTCTCATGGGTCCTACACAGTTCTCTTGTCCTCTCTGCTACAAGACCTTCAACAGATACAACAACA
TGCAGATGCACATGTGGGGACATGGCTCAGAATACAGAAAAGGACCAGAGTCACTAAGAGGGACACAACCAACGGGGATG
CTGAAGCTGCCTTGCTACTGTTGCGCACCGGGCTGCAAGAACAACATTGAGCACCCGAGGGCAAGGCCGCTCAAGGACTT
CCGTACGCTTCAGACACATTACAAGCGGAAACACGGTGCGAGGCCCTTTGCTTGTCGTAGATGTGGAAAGGCTTTTGCGG
TCAAAGGAGACTGGAGGACGCACGAGAAGAACTGTGGGAGGCTTTGGTATTGCTCATGCGGCTCGGATTTCAAGCACAAG
AGGTCGCTTAAGGACCACGTCAAGGCCTTTGGTAATGGTCATGTCCCTTGTTTTGGCATTGATTGCTTCGGCGATCATGA
GGACGAGGAGGCTGCTTCTGATGTCGAACAGCAAGAATGA