Details for Kale Locus Bo5g105130

Position : C5 ( 5`- 33492589 .. 33493543 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g105130

Protein [Map View]
MIYRGYGDGSEMGPKRQRMIEQAPPPVTFYGPHPGSAFMFNPYGFVPPLPVFPVVRLRGLPFDCAELDVVEFFRGLDVVD
VLFVHKNNKVTGEAFCVLGVPLQVDFALHKNRQNMGRRYVEVFRSTKQEYYKAIANEVAESRVHCTVTAGGGSGVNGGHS
PRRNVQRARSSDDGQGNADHTGILRLRGLPFSAGKEDILDFFKDFDLSEDSIHVTVNGEGRPTGDAFVEFGSAEESRAAM
VKDRKMLGSRYIELFPSSVEELEDALSRGR*

DNA
ATGATCTACAGAGGATATGGAGATGGGAGTGAAATGGGACCTAAGAGACAGAGAATGATTGAACAAGCTCCTCCTCCAGT
AACATTCTACGGACCTCATCCCGGTTCCGCCTTTATGTTTAACCCCTACGGATTCGTTCCTCCTCTTCCTGTTTTCCCTG
TGGTTCGACTCCGTGGTCTGCCCTTTGACTGCGCTGAGCTGGACGTTGTGGAGTTCTTCCGTGGCTTAGATGTGGTTGAT
GTCTTGTTTGTCCACAAGAACAATAAGGTCACTGGTGAAGCCTTTTGTGTTCTTGGCGTTCCTCTCCAGGTCGATTTCGC
GTTACATAAGAACAGGCAGAACATGGGGAGGAGATATGTGGAGGTTTTCAGGAGTACTAAGCAGGAGTACTATAAGGCTA
TTGCTAATGAGGTTGCGGAGTCTCGTGTCCATTGTACGGTTACTGCTGGTGGTGGGAGCGGTGTAAATGGTGGACATTCG
CCTCGTAGAAACGTGCAGAGGGCTAGATCGAGTGATGATGGCCAAGGGAATGCTGACCATACGGGTATCTTGAGATTGAG
AGGATTACCTTTCTCGGCGGGGAAGGAAGACATACTTGACTTCTTCAAAGATTTTGATCTGTCTGAAGACTCTATTCATG
TTACCGTCAACGGTGAAGGGAGACCCACTGGAGACGCGTTTGTAGAGTTTGGGAGCGCTGAAGAATCCAGAGCTGCGATG
GTCAAGGACAGGAAGATGCTCGGGAGCCGGTACATAGAACTGTTTCCTTCTTCGGTTGAAGAGTTAGAGGATGCACTATC
AAGGGGAAGGTGA