Details for Kale Locus Bo5g105120

Position : C5 ( 5`- 33482865 .. 33483287 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g105120

Protein [Map View]
MASRKARKPNRAEKKLKRTHFKKKLPQHKNTDTPTILDHTSSSTIVSPCSSTTTTFSPKDTSYSVHSPSPKVLTSSPGKG
GVGDGCCTPKSQKSRIPEMLTCPPAPKKQRVPPNCTLRRRQIVFFAPPEIELFFVKANHQ*

DNA
ATGGCATCAAGAAAAGCAAGAAAACCAAACCGAGCTGAGAAGAAACTCAAAAGAACCCATTTCAAGAAAAAGCTTCCACA
ACACAAGAACACCGACACACCCACTATTCTCGACCATACTTCTTCATCTACTATTGTCTCCCCGTGTTCTTCCACAACGA
CGACGTTTTCACCTAAAGACACAAGCTACTCTGTTCACTCTCCTTCTCCGAAGGTGCTGACGTCGTCACCGGGTAAAGGT
GGTGTCGGCGACGGTTGTTGTACCCCAAAATCTCAAAAGTCTCGGATACCGGAGATGCTGACGTGTCCACCAGCGCCGAA
GAAGCAAAGAGTCCCACCGAACTGCACGTTACGTCGGAGACAGATCGTTTTCTTTGCTCCTCCAGAGATAGAGCTCTTCT
TCGTCAAAGCAAACCATCAATAA