Details for Kale Locus Bo5g105110

Position : C5 ( 5`- 33478584 .. 33480354 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g105110

Protein [Map View]
MESEDMHSKKPDGGNQIVSEVVHHHTSSSSINSLNPWQRAAAACNASSLVEEAGDKSIALENQNNWESTNGSKSPSNRDD
NGNKESPQVTTSPQESAGDYSEKSQELVHVGVTGPPHPQLVSHTVGWASSNPYQDPYYAGMMGAYPMAYVPYGGMPHSRM
PLPPEVAQEPVYVNAKQYQAILRRRQARAKAELEMKLIKSRKPYLHESRHQHAMRRPRGTGGRFAKKTNTEASQPKPGEK
NNATQSPTSSHSDQPEAWNDECRKQSEEMQSSASKRREEADCSGQQWNSISSNHTSQARLAIK*

DNA
ATGGAAAGTGAAGACATGCATTCGAAGAAACCTGACGGTGGGAATCAGATCGTTTCAGAGGTGGTTCATCATCATACATC
ATCTTCCTCCATAAATAGTTTAAACCCTTGGCAACGTGCTGCTGCTGCCTGCAATGCAAGTTCTTTAGTGGAGGAAGCTG
GAGATAAGTCGATAGCGTTGGAGAACCAAAACAATTGGGAATCAACCAATGGGTCCAAGTCACCATCTAATAGAGATGAT
AATGGTAACAAGGAATCACCACAAGTCACAACCTCTCCCCAAGAATCAGCTGGAGATTACAGTGAAAAAAGTCAAGAACT
TGTGCATGTTGGCGTCACAGGACCTCCTCACCCTCAACTTGTTAGCCACACAGTTGGATGGGCATCCTCAAATCCGTACC
AGGATCCTTATTATGCTGGAATGATGGGAGCCTATCCCATGGCTTATGTTCCATATGGTGGGATGCCTCATTCAAGAATG
CCACTGCCTCCTGAGGTTGCACAGGAACCAGTTTATGTGAATGCTAAACAGTACCAGGCGATACTTAGGCGAAGGCAGGC
ACGCGCCAAGGCTGAGCTTGAAATGAAGCTAATCAAATCCAGAAAGCCTTATCTCCATGAATCTCGGCATCAGCATGCTA
TGAGGAGGCCTAGGGGCACTGGAGGACGGTTTGCAAAGAAAACAAACACCGAAGCTTCACAGCCAAAACCTGGAGAAAAG
AACAATGCTACTCAGTCCCCGACGTCATCTCACTCTGACCAACCTGAAGCCTGGAATGATGAGTGTAGAAAACAGTCTGA
AGAGATGCAAAGCTCAGCTTCTAAGAGAAGGGAAGAAGCAGACTGTTCAGGGCAACAATGGAACAGCATTTCCTCAAACC
ATACTTCTCAAGCTCGTCTAGCCATCAAATGA