Details for Kale Locus Bo5g105000

Position : C5 ( 5`- 33420248 .. 33420562 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g105000

Protein [Map View]
MASMTMTATFLPAVAKLPSTTGGRRLSVIRASTSDNTTSLQVKETQNSTTMRRDLMFTAAAAAVCSLAKVAMADEEEPKR
GTDAAKKKYAQVCVTMPTAKICRY*

DNA
ATGGCATCGATGACCATGACAGCCACATTCCTCCCTGCCGTCGCTAAGCTCCCCTCAACCACCGGCGGACGAAGGCTCTC
GGTGATCAGAGCTTCAACGAGCGACAACACAACCAGCTTACAAGTCAAGGAGACACAGAACAGCACCACGATGAGGAGGG
ATCTCATGTTCACAGCTGCTGCTGCGGCCGTTTGTTCCTTGGCTAAGGTAGCCATGGCAGACGAGGAGGAGCCCAAACGA
GGGACAGATGCAGCTAAGAAGAAGTACGCTCAAGTTTGTGTCACAATGCCGACAGCCAAGATCTGTCGCTACTGA