Details for Kale Locus Bo5g104970

Position : C5 ( 5`- 33372999 .. 33376683 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g104970

Protein [Map View]
MELEGSSSCPRPLPSKAEMSRGAYLAWEDLTVVIPNFSDGPTRRLLQRLNGYAEPGRIMAIMGPSGSGKSTLLDSLAGRL
ARNVIMTGNLLLNGKKARLDYGLVAYVTQEDILLGTLTVRETITYSARLRLSSDMSNEEVSDIVEGTIMELGLQDCADRA
IGNWHARGVSGGERKRVSIALEILTRPQILFLDEPTSGLDSASAFFVIQTLRNIARDGRTVISSIHQPSSEVFALFDDLF
LLSSGESVYFGEAKSAVEFFAESGFPCPKKRNPSDHFLRCINSDFDTVTATLKGSQRIQDTPATSDPLLNLATPVIRARL
VENYRRSKYAKSAKSRIQELSNIDGNEMEVRRGSEASWWKQLRTLTARSFINMCRDVGYYWTRIVSYIVVSISVGTIFYD
VGYSYTSILARVSCGGFITGFMTFMSIGGFPSFLEEMKVFYKERMSGYYGVSVYILSNYISSFPFLVSLSVITGTITYNL
VKFRPGFSHYAFFCLNIFFSVSVIESLMMVVASLVPNFLMGLVTGAGLIGIIMMTSGFFRLLPDLPKIFWRYPVSYISYG
SWAIQGGYKNDFLGLEFEPLFPGEPKMTGEEVINKIFRVKVTHSKWWDLAAVVGILVCYRLLFFVVLKLKERAGPALKAI
QAKRTMRNLDRRPSFKRMPSLSLSLSSMSSRRHQPFRSLSSQEGLNSPAHY*

DNA
ATGGAACTAGAGGGCTCGAGTAGTTGCCCGAGGCCGCTACCGTCAAAGGCGGAGATGAGCCGTGGAGCGTATTTGGCATG
GGAAGACTTAACGGTGGTTATACCCAACTTCAGTGATGGTCCGACCCGAAGGTTGCTACAGAGGCTAAACGGGTATGCTG
AACCAGGTCGGATCATGGCTATAATGGGTCCTTCTGGATCCGGAAAGTCCACTCTTCTTGACTCTCTTGCAGGTAGACTA
GCAAGAAACGTGATCATGACCGGTAATCTTCTATTGAACGGCAAGAAAGCCAGACTAGACTATGGTCTCGTAGCATATGT
AACACAAGAGGACATATTGCTCGGAACACTAACAGTGAGGGAGACAATAACATACTCAGCTCGATTGAGGCTTTCAAGTG
ACATGTCTAACGAGGAAGTGAGTGACATTGTGGAAGGCACAATCATGGAGCTTGGTCTTCAAGACTGCGCAGACAGAGCC
ATTGGAAACTGGCACGCTAGGGGAGTTAGTGGCGGCGAACGGAAACGTGTCAGCATCGCTTTAGAGATCTTAACGCGCCC
TCAGATCCTCTTTCTCGACGAACCCACCAGCGGTTTGGATAGTGCTTCTGCGTTTTTCGTGATTCAGACACTTAGAAACA
TCGCAAGAGATGGCAGAACCGTTATTTCATCGATTCATCAGCCTAGCAGTGAGGTGTTTGCACTGTTTGATGATCTTTTC
TTGCTCTCGAGTGGTGAGTCTGTCTACTTTGGTGAAGCCAAGTCTGCCGTTGAGTTCTTTGCTGAATCGGGCTTTCCATG
CCCCAAGAAGAGGAATCCTTCTGATCACTTCCTGCGATGTATAAACTCAGACTTTGATACAGTCACAGCTACGCTCAAAG
GATCTCAAAGAATTCAGGACACACCAGCTACATCAGATCCACTTTTGAATCTAGCAACACCTGTGATCAGAGCAAGGCTT
GTTGAGAACTACCGGCGTTCAAAGTATGCGAAATCCGCAAAATCTAGAATCCAAGAACTATCTAACATCGATGGGAATGA
GATGGAAGTGAGAAGAGGGAGTGAAGCGAGCTGGTGGAAACAACTTAGGACATTAACAGCAAGATCATTCATAAACATGT
GTCGCGATGTAGGTTACTACTGGACAAGAATAGTAAGCTACATTGTTGTTTCTATAAGCGTAGGGACCATATTCTACGAC
GTGGGATATAGCTACACATCAATCTTAGCCAGGGTCTCTTGTGGCGGATTCATCACCGGTTTCATGACGTTCATGTCCAT
TGGAGGCTTCCCTTCTTTCCTTGAAGAGATGAAGGTGTTCTATAAAGAGAGGATGAGTGGTTACTATGGAGTTTCGGTTT
ATATCCTCTCAAACTACATCTCGTCTTTCCCGTTCTTAGTTTCTCTCTCGGTTATCACGGGAACTATTACTTACAACTTG
GTGAAGTTTCGTCCCGGGTTCTCGCATTACGCTTTCTTCTGTCTCAACATCTTCTTCTCAGTCTCTGTGATAGAGAGTCT
CATGATGGTTGTGGCTTCTCTAGTTCCAAACTTTTTGATGGGTCTTGTTACTGGAGCTGGTCTCATTGGAATCATCATGA
TGACTTCTGGATTCTTCCGTCTGCTTCCTGATCTTCCCAAGATATTTTGGCGTTACCCGGTTTCGTATATAAGCTATGGA
TCTTGGGCTATCCAGGGAGGTTACAAGAATGATTTTCTCGGACTAGAGTTTGAGCCTTTATTCCCGGGTGAGCCGAAAAT
GACAGGAGAAGAAGTGATAAACAAGATATTTAGAGTGAAGGTGACACATTCAAAATGGTGGGACTTGGCTGCTGTTGTAG
GAATCCTTGTGTGTTATAGGCTTCTCTTCTTTGTGGTCTTAAAGCTAAAGGAGAGAGCAGGACCGGCTTTAAAGGCGATT
CAGGCAAAAAGAACGATGAGGAATCTTGACAGGAGACCTTCTTTCAAGAGAATGCCGTCTCTGTCTTTGTCATTGTCGTC
AATGTCTTCAAGGAGACATCAGCCTTTCCGTTCACTTTCTTCTCAAGAAGGCCTCAACTCTCCAGCCCACTACTAA