Details for Kale Locus Bo5g104940

Position : C5 ( 5`- 33334918 .. 33337646 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g104940

Protein [Map View]
MDPGDPTSILFTKIRTLEPDFASKIIGYLLLQDLGKRDLMRLALGPDTLLQSVCLKAKSALGLSSNGSSSSGTTTPLNPI
SRPINIHRHSPRNGPFMEFSRSPSLNNTPGSNNPNVGSSPFQASSSLFASDGGGDDLVDEGQLGNYLSFLNESSSKNNNN
NDENTDLFGFSGDNDDAHLHKRSFSASDVCFGSQEPGYGGYCRFPGLGDDFESPGGGFGSPDFRQQEEIARMNLAQRQRM
AAAQFLAASGGSPMSYDKGINFLLGSRNAHHRSGGAGQFGDEGYWFGSPGRHEREEFMGMGDKSNSASKQIYLTFPADSS
FTDEDVSNYFGNFGPVQDVRIPYQQKRMFGFVTFVHSETVRIILARGNPHFICDSRVLVKPYKEKGRILENRRQQQQLMQ
QMERGNFSPGSSPSGMDARDLFDCHFGPRMFSSTQEMMRRKAEQADLQQALEFQRRRLLNLQLPDLDSESFHHHQRSLSI
GSPVHYPARVNQSMLFGEEGNGDSGHFQSEANRAFLSDSDNNKSHEGGYANHFHKGQETSLENALPDCFFASPSKTGETQ
EQSESENENCATVEKK*

DNA
ATGGATCCTGGAGATCCCACTTCCATACTCTTCACAAAGATCCGAACTTTAGAACCGGACTTCGCCTCCAAAATCATAGG
CTACTTGCTCTTACAGGACTTGGGCAAGAGAGACTTGATGCGTCTTGCTCTTGGACCAGACACTCTCTTGCAGTCCGTTT
GTCTCAAAGCTAAGTCCGCTTTGGGTCTCTCCTCGAACGGATCTTCTTCTTCTGGCACGACGACGCCGTTGAACCCTATC
TCGAGACCCATTAACATCCACCGCCATTCTCCGAGGAATGGCCCGTTTATGGAGTTCTCGAGGAGCCCTTCCTTGAACAA
CACTCCTGGGAGTAACAACCCTAACGTGGGTTCGAGTCCGTTTCAAGCAAGTTCCTCTCTTTTCGCTTCAGATGGTGGTG
GTGACGATTTAGTCGATGAGGGGCAACTCGGTAACTACTTGTCCTTCCTCAACGAGTCTTCTTCTAAGAACAACAACAAC
AACGACGAAAACACGGATCTGTTCGGGTTCTCGGGTGATAATGACGATGCCCATTTGCATAAGAGGAGTTTCTCAGCAAG
CGATGTTTGTTTCGGGTCACAGGAACCCGGTTATGGCGGTTACTGTCGGTTTCCTGGTTTAGGAGATGATTTCGAGTCTC
CTGGCGGTGGGTTTGGTTCTCCGGATTTCAGACAGCAAGAGGAGATAGCGAGGATGAACCTGGCTCAACGGCAGCGAATG
GCCGCTGCACAGTTCTTGGCGGCTAGTGGTGGCTCACCAATGTCGTATGATAAAGGCATTAATTTTCTCTTGGGTTCGCG
TAACGCTCATCATAGATCAGGAGGAGCAGGACAGTTTGGGGATGAGGGTTACTGGTTTGGTAGTCCAGGGCGACATGAAA
GAGAGGAGTTTATGGGGATGGGAGATAAATCAAACTCTGCATCTAAGCAGATTTACTTGACATTTCCAGCTGACAGCTCC
TTCACAGATGAAGATGTCTCCAATTACTTCGGCAATTTTGGACCAGTGCAGGATGTTAGGATTCCATACCAGCAGAAACG
GATGTTTGGGTTTGTCACTTTTGTCCACTCTGAGACTGTGAGAATCATATTGGCCAGAGGAAACCCACATTTCATCTGCG
ACTCACGCGTGCTTGTTAAACCCTACAAAGAGAAAGGAAGAATCCTTGAAAATAGGAGGCAGCAGCAACAACTGATGCAG
CAGATGGAGAGAGGGAACTTTTCTCCTGGTTCAAGTCCATCTGGAATGGACGCAAGGGATCTCTTTGATTGCCACTTCGG
ACCGAGGATGTTTTCTAGCACACAAGAGATGATGAGGAGAAAAGCTGAGCAAGCTGACTTACAACAAGCATTAGAATTCC
AAAGGAGAAGACTTCTCAATCTCCAGTTACCCGACTTGGATAGCGAGTCGTTTCACCATCACCAGCGCAGTCTTTCTATT
GGCTCCCCTGTTCATTACCCCGCCCGCGTCAATCAAAGCATGCTCTTTGGTGAAGAAGGTAATGGTGATTCAGGACATTT
TCAGTCTGAAGCAAACCGTGCTTTTCTGTCTGATTCTGATAATAACAAGAGCCACGAAGGTGGTTACGCTAACCATTTCC
ACAAAGGGCAAGAGACAAGTCTGGAGAACGCTCTGCCTGATTGCTTCTTTGCTTCCCCATCAAAGACCGGTGAAACCCAA
GAACAGTCCGAGTCTGAGAATGAGAACTGTGCTACTGTGGAAAAAAAGTAG