Details for Kale Locus Bo5g104890

Position : C5 ( 5`- 33317435 .. 33321835 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g104890

Protein [Map View]
MGSSKVHDDGPSRFCTRCYMRIYRERREFHSFEVDGNPASEASGTLCAAKEHELILVDTKYEFGKSYDGSILLIDEVLPG
APATELAWCSYLGLVQQEGFENLEAIRSAGVKTWTDEEFRYFLTLYAEEKKKGNRPRTDMNSVGREFIPRKFEERFSKKW
IWDRFKNKVDVCRKAYVKFKKLTHNRTGLVYDAMGRLEMPDAWWDQRIANLSMHCSLSLIALIM*

DNA
ATGGGTAGCAGTAAGGTCCATGATGATGGACCCTCAAGATTTTGTACTCGTTGTTACATGAGGATTTACCGAGAGCGTAG
AGAGTTCCATTCTTTTGAGGTAGATGGGAACCCTGCCAGTGAAGCCTCCGGAACCCTATGTGCCGCCAAGGAGCATGAAC
TGATACTGGTGGATACAAAATATGAGTTTGGAAAAAGTTACGATGGTTCAATCTTATTGATTGATGAGGTCCTCCCCGGT
GCTCCAGCTACTGAATTAGCTTGGTGTTCTTATCTTGGTTTGGTACAACAGGAAGGCTTTGAAAACTTGGAAGCAATAAG
AAGCGCTGGTGTTAAGACCTGGACCGACGAAGAATTTCGGTATTTTCTTACTCTTTATGCTGAAGAAAAAAAGAAAGGGA
ACAGACCAAGGACTGACATGAATTCAGTTGGAAGAGAGTTCATCCCTAGGAAGTTTGAAGAGAGATTTAGTAAGAAATGG
ATATGGGACAGGTTTAAGAACAAGGTTGATGTTTGTAGAAAAGCATATGTCAAGTTTAAGAAGCTGACTCACAACAGAAC
CGGACTTGTCTATGATGCTATGGGACGGTTGGAGATGCCAGATGCTTGGTGGGATCAACGCATAGCGAACTTGAGTATGC
ATTGTTCTCTTAGTCTTATTGCTTTAATAATGTGA