Details for Kale Locus Bo5g104860

Position : C5 ( 5`- 33281226 .. 33282368 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g104860

Protein [Map View]
MTGQEKKRKNTISLPTDLLVEILSRVPEASLARLRSTSKEWNALIKKEVRRAKKSLVVMLIDYRVYLVRLDLHDNFAKVR
SQFSLNDPLSSSSEEVDVRRVCHCDGLLLCTTMDERLVVWNPCSGETSRIVKPLNSHHYTDTYALGKSSCNNEYKISRVH
HPGHGFGRPCLVKYEIYDFTSNLWRLVGETREWSLPGAWQYGTSVDGNTYWLSYDFNQACPTNVNTLGCFDFTIERFGCV
SLPVDPLSYYVYALSVTREEQKLCLLTYRYEGQDIDIWMATKIKITGDMSWSKLLTVKRTHPLCNGMSFLADRENKVLVC
PTKYKNSSNCLHIVGTDKYIQVDHHDVGSESSLPYRYDDPTLVQIQRGSLGLGTWKAPMT*

DNA
ATGACGGGCCAAGAAAAGAAGAGGAAAAACACAATATCTCTTCCTACAGACTTGCTTGTGGAGATACTCTCTAGGGTTCC
AGAGGCTTCTCTTGCACGACTCCGATCTACCTCAAAAGAATGGAACGCTCTTATCAAAAAAGAAGTGAGACGTGCGAAGA
AGTCTCTTGTTGTCATGTTAATTGATTATAGGGTCTATTTAGTTAGGCTTGATCTCCACGACAACTTTGCAAAGGTAAGA
AGTCAGTTCAGCCTTAATGATCCTCTTTCTAGTTCTTCAGAAGAAGTCGATGTACGCCGCGTCTGCCACTGCGATGGTTT
ATTGCTATGCACCACCATGGACGAAAGACTAGTTGTTTGGAACCCATGTTCAGGGGAAACCAGTAGGATTGTCAAACCCT
TAAATTCCCACCATTATACCGATACCTACGCTCTTGGTAAATCCTCATGCAACAACGAGTACAAAATCTCGAGGGTCCAT
CATCCTGGACATGGTTTCGGGCGGCCATGCCTTGTTAAGTACGAAATCTATGACTTTACATCTAATTTGTGGAGGCTTGT
TGGTGAGACTAGAGAGTGGTCACTTCCAGGGGCTTGGCAATATGGCACGTCTGTTGATGGAAATACTTATTGGCTTTCTT
ATGATTTTAATCAAGCCTGTCCAACCAACGTAAATACCTTAGGATGTTTTGATTTTACAATAGAGAGGTTTGGATGTGTG
TCTCTTCCGGTTGATCCTCTTTCTTATTATGTTTATGCTTTATCAGTGACTAGAGAAGAGCAAAAACTTTGTCTGTTAAC
TTATCGTTACGAGGGACAAGATATAGATATATGGATGGCAACTAAAATTAAAATTACTGGAGACATGTCGTGGAGTAAGC
TCCTAACAGTGAAACGAACCCATCCGCTTTGTAATGGGATGAGTTTCTTGGCCGACCGTGAGAATAAAGTTTTAGTGTGT
CCCACTAAATATAAGAACTCTAGTAACTGCTTACACATTGTGGGAACGGATAAATACATACAAGTAGACCATCATGACGT
CGGATCTGAATCCTCACTTCCTTACAGGTATGATGATCCTACTTTGGTTCAAATCCAACGAGGTTCTTTGGGGCTAGGCA
CATGGAAAGCACCAATGACGTAA