Details for Kale Locus Bo5g103600

Position : C5 ( 5`- 33001679 .. 33003993 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g103600

Protein [Map View]
MEALSTSSSYISNPLPKTKHLFKSSHLPLVASSQSSYWLCKSPPKLRIRDGSSHGLRIQALLHNEGEGEDNLGESNGFGF
FPGDIFSLSQEKLESETSHSVIDVESSLALPQGAGNSGGNRGGLFRTPISGGVQNATSAHALPRPALAVRNLLEQARFAH
LCTVMSKMHHRREGYPFGSLVDFAPDRMGHPIFLFSPLAIHTRNLLAEPRCSLVVQIPGWSGLSNARVTLFGDVYPLSED
EQGRIGHCCSSMRFTSIRDDDGAEPPWRRRRRWLSDGFVVVRARSRLWRRSLARTEHDKTMSHLREPSRHWSRDVKKLSS
GLETKKNESELKLVEVRSGLAKRVNEVVTS*

DNA
ATGGAAGCTCTCTCTACTTCGTCTTCATACATCTCTAATCCTCTCCCGAAAACAAAGCATCTCTTCAAATCTTCCCACCT
GCCACTCGTAGCTTCATCCCAGTCTTCGTACTGGCTCTGTAAGTCGCCACCCAAGCTGAGAATCAGAGATGGATCAAGTC
ACGGCCTTCGTATACAAGCTCTCTTACACAACGAGGGTGAAGGTGAAGACAATCTCGGCGAAAGCAATGGGTTTGGCTTC
TTTCCTGGGGACATCTTCTCTTTATCACAGGAAAAGCTTGAGAGTGAGACTTCTCATAGTGTAATAGACGTGGAGTCATC
TCTTGCACTTCCTCAGGGTGCTGGGAACAGTGGGGGAAATCGAGGTGGGCTTTTTAGAACTCCCATATCTGGTGGAGTTC
AGAATGCGACGTCAGCTCATGCGTTGCCTAGGCCTGCTTTGGCTGTAAGGAACTTGCTGGAGCAGGCTAGGTTTGCTCAT
CTATGCACGGTGATGTCTAAAATGCACCACCGAAGGGAAGGTTACCCATTTGGCTCTTTGGTGGATTTTGCACCTGATCG
TATGGGGCATCCAATCTTTTTATTTTCACCGTTGGCCATCCACACAAGAAATCTCTTGGCTGAACCTAGATGCAGTCTCG
TTGTTCAGATACCTGGATGGAGTGGCCTGTCGAATGCAAGAGTAACATTATTCGGTGATGTGTACCCATTATCAGAAGAT
GAGCAGGGAAGAATTGGCCATTGTTGCTCTTCGATGAGGTTTACTTCGATCCGCGACGATGACGGAGCTGAGCCACCATG
GCGGAGGAGAAGACGATGGCTTAGTGATGGGTTCGTGGTGGTCCGAGCACGATCTCGTCTTTGGAGAAGGAGCCTCGCCA
GAACAGAGCACGACAAGACCATGAGCCACCTCCGAGAGCCTTCACGTCATTGGAGTCGCGATGTGAAGAAGTTAAGCTCG
GGTCTTGAGACAAAGAAAAACGAATCGGAGCTCAAGCTCGTGGAGGTTCGTAGCGGCTTGGCAAAGCGGGTTAATGAGGT
CGTCACATCATGA