Details for Kale Locus Bo5g103590

Position : C5 ( 5`- 32998155 .. 32998826 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g103590

Protein [Map View]
MVKSCELCGAEADLHCAADSAFLCRSCDAKFHASNILFSRHVRRTICPGCKSLTGDSFSGPLSPSPRTTACCCGSSSESS
CCSSLDRVSSSELSSTKTSRAVVNKARGREKRVMAAADGVLVKWCDELGLNGDLRNAVVSLASLALAVEKPTKVILAAAF
WFGVRNSPKKVMRPSLKKVADVSGVAAGMIRAVESKLARAVTLQLKRWRVDSEEGWGENENGM*

DNA
ATGGTGAAATCCTGTGAGCTGTGTGGTGCAGAAGCCGATCTCCACTGCGCCGCGGACTCCGCTTTCCTCTGCCGCTCCTG
CGACGCCAAGTTCCACGCCTCTAACATCTTGTTTTCCCGCCATGTCCGCCGCACCATCTGCCCTGGCTGCAAATCCCTCA
CCGGAGATTCCTTCTCTGGTCCTCTTTCCCCTTCGCCTCGGACGACAGCCTGCTGCTGCGGATCATCTTCGGAGTCTTCT
TGCTGCTCGTCGCTGGATCGTGTCTCAAGCTCCGAGCTATCGTCGACGAAGACGTCGCGTGCCGTCGTGAACAAAGCGCG
AGGGAGGGAAAAGAGAGTGATGGCAGCTGCGGATGGCGTTTTGGTAAAATGGTGCGATGAGTTAGGACTAAACGGAGATT
TGAGAAACGCCGTCGTTTCGTTGGCGTCTCTCGCTTTGGCCGTGGAGAAGCCGACGAAGGTGATTTTAGCGGCGGCGTTT
TGGTTCGGCGTTAGGAACTCGCCGAAGAAGGTGATGCGGCCGAGTCTAAAGAAGGTGGCTGATGTGAGCGGGGTTGCAGC
TGGAATGATACGAGCCGTCGAAAGCAAGCTGGCGCGTGCAGTGACGTTGCAGCTTAAACGGTGGCGCGTGGACTCGGAGG
AAGGATGGGGTGAAAACGAGAATGGTATGTGA