Details for Kale Locus Bo5g103570

Position : C5 ( 5`- 32986167 .. 32989608 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g103570

Protein [Map View]
MARSKAVVSGSHHGIWKYFNPAYYLRRPRRLALLFFLFLSVSMVLWDRHSLSRDYQLEVSKLNEEVMRLQLLLEDVKSVV
TEDVSVNSTLKDVQEDPLDAQRMQRVKEAMIHAWSSYEKYAWGQDELQPQTKDGVDSFGSLGATMIDALDTLYIMGLDEQ
FQKAREWVATSLDFDKDYDASMFETTIRVVGGLLSAYDLSGDKLFLDKAKDIADRLLPAWDTPSGIPYNIINLRHGNAHN
PTWAGGDSILADSGTEQLEFIALSQRTGDPKYQQKVEKVISVLNKNFPADGLLPIYISAETANPSHSTITFGAMGDSFYE
YLLKVWVFGSKTLSVKHYRDMWEKSMNGLVSLVKKSTPSSFTYICEKSGTSLSDKMDELACFAPGMLALGASGYNDPAEA
KKFLTLAEELAWTCYNFYESTPTKLAGENYFFNSGSDMSVGTSWNILRPETVESLFYLWRLTGNKTYQDWGWNIFEAFEK
NSRIESGYVGLKDVNTGVKDNKMQSFFLAETLKYLYLLFSPTTVIPLDEWVFNTEAHPLKIVPWNDQVNLGQSTAVQQRK
PTIRLRQRRIGRMTNK*

DNA
ATGGCGAGGAGTAAGGCGGTGGTGAGTGGTAGTCATCATGGGATATGGAAATATTTCAACCCAGCTTATTATCTCAGAAG
GCCTAGGCGTCTTGCTCTTCTTTTCTTCCTCTTCCTCTCCGTTTCCATGGTCCTTTGGGATCGTCATTCTCTCTCCCGTG
ATTACCAGCTTGAAGTTTCCAAGTTAAATGAAGAAGTTATGCGGTTGCAGCTGTTGTTAGAAGATGTAAAAAGCGTCGTC
ACGGAGGATGTATCTGTGAATAGTACATTGAAGGATGTCCAGGAAGATCCGCTTGATGCCCAGAGAATGCAGAGAGTAAA
AGAAGCAATGATTCATGCTTGGAGTTCATACGAAAAGTATGCCTGGGGACAAGATGAGCTTCAGCCCCAGACAAAAGATG
GAGTTGACAGCTTTGGTAGCCTGGGAGCAACTATGATAGATGCATTAGATACACTCTACATAATGGGTCTAGATGAGCAG
TTTCAAAAAGCCAGGGAGTGGGTTGCAACCTCATTAGATTTCGACAAGGATTATGACGCCAGTATGTTCGAGACAACTAT
AAGAGTGGTGGGAGGGCTTCTCAGCGCGTATGATCTTTCTGGGGATAAACTTTTCCTTGATAAGGCTAAGGATATAGCAG
ACAGATTATTGCCAGCATGGGACACTCCCTCGGGTATACCATATAACATTATCAACTTGAGACATGGAAATGCTCACAAT
CCTACATGGGCAGGGGGAGACAGTATTCTTGCAGATTCTGGTACTGAACAGCTCGAGTTTATTGCCCTTTCCCAGAGGAC
GGGAGACCCAAAATATCAACAAAAGGTAGAAAAGGTTATTTCAGTACTAAATAAGAACTTCCCTGCTGATGGTCTACTTC
CGATTTATATAAGTGCCGAGACAGCTAATCCATCGCACTCTACCATAACATTTGGTGCCATGGGAGACAGCTTTTATGAA
TATTTGCTCAAAGTTTGGGTGTTTGGGAGCAAAACTTTATCAGTGAAACACTATAGGGATATGTGGGAGAAATCAATGAA
TGGTCTGGTAAGCTTGGTTAAGAAATCAACACCTTCGTCGTTTACATATATCTGTGAGAAGAGTGGAACCTCTTTGTCGG
ACAAGATGGATGAGTTGGCATGCTTTGCTCCTGGAATGTTGGCTTTAGGAGCATCTGGGTATAATGATCCCGCTGAAGCA
AAGAAGTTTCTCACCCTTGCTGAAGAGCTTGCATGGACATGTTATAACTTCTACGAATCAACACCAACAAAACTGGCTGG
GGAGAATTATTTCTTCAACTCTGGGAGTGACATGAGTGTTGGAACATCGTGGAACATTTTGAGACCAGAAACTGTGGAAT
CACTGTTTTACCTCTGGCGGTTAACTGGTAACAAGACATATCAAGACTGGGGATGGAATATATTTGAAGCGTTTGAGAAG
AACTCTCGCATAGAGTCTGGATATGTCGGTTTAAAGGATGTTAATACAGGAGTTAAGGACAACAAGATGCAAAGTTTCTT
CCTTGCTGAGACGCTCAAGTATCTCTATCTCCTCTTCTCCCCCACAACGGTGATTCCCTTGGACGAGTGGGTATTCAACA
CAGAAGCTCATCCACTTAAGATTGTGCCCTGGAATGATCAGGTGAATCTCGGACAATCCACGGCCGTGCAGCAACGCAAA
CCAACAATTAGATTACGCCAGAGGCGGATTGGTCGGATGACAAACAAGTAA