Details for Kale Locus Bo5g103560

Position : C5 ( 5`- 32981267 .. 32982739 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g103560

Protein [Map View]
MDDDGLHGNNGGMHSGGDELPMHVQYEHHGMMDEHADDGMNGGLETDIPSHLGNPSDHRGEVVDRGGENGDQLTLSYQGQ
VYVFDHVLPEKVQAVLLLLGGREVPQTLPTTVGSPHQNNRGLSGTPQRFSAPQRQASLLRFREKRKGRNFDKTIRYTVRK
EVALRMQRKKGQFTSAKSSNEESALTGPDWGSGQSWALEGCETQKPEALCRHCGTSENSTPMMRRGPEGPRTLCNACGLM
WANKGALRDLSKAPPPQITRNLPTNKNDESNLEADQMMVVAGDISNSN*

DNA
ATGGATGATGATGGCCTTCATGGAAACAACGGTGGAATGCACAGTGGCGGAGATGAACTTCCAATGCATGTGCAGTATGA
GCATCACGGCATGATGGATGAACACGCTGATGATGGGATGAATGGTGGACTTGAGACAGACATCCCTTCTCACCTTGGAA
ACCCATCTGATCATCGCGGCGAAGTTGTGGACCGTGGCGGTGAAAACGGAGACCAGTTGACGTTGTCCTATCAGGGACAA
GTTTATGTTTTTGACCATGTCTTGCCTGAGAAGGTTCAAGCTGTGCTTTTGTTACTTGGTGGAAGAGAAGTACCACAGAC
GCTCCCGACAACCGTAGGATCACCTCATCAGAACAATAGGGGTTTATCTGGTACTCCTCAAAGGTTTAGTGCCCCGCAGA
GGCAAGCCTCGTTGCTCAGATTCAGGGAGAAAAGAAAAGGGAGGAACTTTGACAAGACCATTCGCTACACAGTCAGGAAG
GAGGTAGCATTGAGGATGCAGCGTAAGAAAGGTCAGTTCACATCTGCCAAATCAAGCAATGAGGAATCTGCATTAACAGG
ACCGGATTGGGGATCAGGCCAGAGCTGGGCCTTAGAAGGGTGTGAAACTCAGAAGCCAGAGGCTTTATGTCGGCACTGTG
GAACGAGTGAGAATTCAACACCAATGATGCGACGTGGACCTGAAGGGCCAAGGACACTTTGTAATGCATGTGGACTGATG
TGGGCAAACAAGGGAGCTCTTAGAGACTTATCCAAAGCCCCTCCTCCTCAAATAACCAGGAATCTGCCTACAAATAAGAA
TGATGAATCTAATCTTGAGGCTGATCAAATGATGGTAGTAGCTGGTGACATTAGCAACTCAAACTGA