Details for Kale Locus Bo5g103540

Position : C5 ( 5`- 32971546 .. 32973605 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g103540

Protein [Map View]
MGVDLRQVVAGILTITMFVMLGQMLHRDYFDSLQEKAQGDAHDIEFEGSRVSVKDSLVGALEGSKGPWMDDNNDLNPCWP
TLLSDEAVSSKGYVTFSLTNGPEYHISQITDAVMVAKHLGATLVLPDIRGSKPGDERNFEDIYDADKLIKSLEKVIKVVK
QLPEEVSLRDMAIIKVPTRVTEDYIKENIDPIFKSKGNIRVATYFPSVNLRKSSQDGETDPVACLAMFGSLELQPELNAV
VESMVERLRTHSRKLGDRFIAVDLRIDLLEKKHCHSTGVVGSKTCYNAQEIALFLRKLGFAGDTTIYLTQPRWDSSLDIL
KDIFPKTFTKEAIFPASKKSKYLESESSEYENVIDFYISSRSDVFVPAISGLFYANIVGKRIALGKPQVLVPAEISETSG
LATDFISPYISKKNHLAYSCFC*

DNA
ATGGGTGTGGATTTGAGGCAAGTTGTTGCTGGTATCCTCACCATTACCATGTTCGTGATGCTCGGACAGATGCTTCATAG
AGATTACTTTGATTCTCTTCAGGAGAAAGCTCAGGGAGATGCACACGATATTGAATTTGAAGGATCTAGAGTATCTGTGA
AAGATAGTCTTGTCGGAGCCTTAGAAGGCAGTAAAGGGCCTTGGATGGATGATAACAATGACCTTAATCCTTGTTGGCCA
ACATTACTATCCGATGAAGCGGTATCATCAAAAGGGTATGTTACATTCTCACTAACGAATGGTCCTGAGTACCATATCTC
TCAGATCACTGATGCTGTAATGGTGGCAAAGCATCTTGGAGCAACATTAGTGCTTCCTGATATAAGAGGAAGCAAACCTG
GTGATGAAAGGAACTTTGAAGATATTTATGATGCCGATAAACTAATCAAAAGCTTGGAAAAAGTCATCAAAGTTGTCAAA
CAATTGCCTGAAGAAGTATCTCTAAGGGATATGGCCATTATAAAAGTCCCTACCAGAGTTACAGAGGACTACATTAAGGA
GAACATTGATCCAATCTTCAAATCAAAAGGAAACATCCGAGTTGCTACGTATTTCCCTTCTGTAAACTTGAGAAAATCCT
CACAAGACGGCGAAACTGATCCTGTGGCTTGTTTGGCAATGTTTGGTTCCTTGGAGTTGCAACCTGAACTGAATGCAGTA
GTTGAATCAATGGTTGAGAGGTTAAGAACACATAGCAGGAAATTAGGTGACCGTTTTATAGCAGTAGACCTTAGAATTGA
CTTACTCGAGAAGAAACATTGCCATTCAACTGGCGTAGTAGGGTCCAAGACATGTTACAACGCGCAAGAGATTGCTTTAT
TCTTGAGGAAGCTTGGATTTGCTGGTGACACAACTATCTATCTCACTCAGCCAAGGTGGGACAGTAGCCTCGATATCCTT
AAGGATATCTTCCCAAAAACGTTCACAAAGGAGGCAATATTTCCAGCAAGTAAGAAATCAAAGTACCTTGAATCAGAGAG
TTCAGAGTATGAAAATGTTATTGACTTCTACATAAGCTCGAGAAGCGATGTGTTTGTTCCAGCCATATCTGGTTTGTTTT
ATGCAAACATAGTTGGGAAGAGGATAGCTTTAGGTAAGCCACAAGTGCTAGTTCCAGCAGAAATCTCAGAGACATCTGGC
CTTGCTACAGATTTCATCTCTCCTTACATCTCAAAGAAGAACCACTTGGCTTATTCATGCTTTTGCTGA