Details for Kale Locus Bo5g103530

Position : C5 ( 5`- 32945185 .. 32946830 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g103530

Protein [Map View]
MKLQTQSFALNLLPFPKFDKREFIPPKRDPISSLRCSVSTPLTATNHQLSASSHKPFPAEVSRSIMELSSVGTLSTLTHD
GWPLGVGVRFAVDGEGTPVLCLNRALSPDKRSALHVQLEQCGLRTPQCTIQGSIARPGDDNAVKRLSATWRKRFGEEVEE
DSLYVVAVDRVLQIEDFMEDGIWVASADYKNASPDPLRDVAQDIVNQINANNMEDIFRFCNVYVDLDFVVSETKMIWMDR
LGFDLRVWSPRGVYDVRIPFPMEVTDEKGAKSSFNGMSQLAWEVEKSYYPADFNKVKLLKPVVGSLQKGQ*

DNA
ATGAAGCTCCAAACCCAATCCTTCGCTCTCAACCTTCTCCCATTTCCGAAATTCGACAAACGCGAATTCATCCCCCCAAA
ACGAGACCCAATCTCCTCCCTCCGATGCTCCGTCTCCACGCCGTTGACGGCGACCAATCACCAGCTCTCCGCGTCGAGCC
ACAAGCCCTTTCCGGCGGAGGTTTCGAGGAGCATCATGGAGCTTTCATCGGTCGGAACTCTCTCCACTTTGACCCACGAC
GGATGGCCGCTCGGCGTCGGCGTTCGCTTCGCCGTTGACGGAGAGGGTACTCCTGTTCTCTGCCTCAATCGCGCATTGTC
TCCTGACAAGAGGTCTGCTCTTCATGTTCAGTTGGAGCAATGTGGATTGAGGACTCCTCAGTGCACGATACAAGGTAGCA
TTGCTCGACCTGGAGACGATAATGCTGTAAAGCGTCTTAGTGCTACATGGAGGAAAAGGTTTGGCGAAGAAGTTGAGGAA
GACAGTTTATATGTTGTTGCTGTTGACCGTGTGCTTCAAATTGAAGACTTCATGGAGGATGGGATTTGGGTGGCGTCAGC
AGATTATAAAAATGCAAGTCCTGATCCTCTTCGAGATGTTGCACAAGACATTGTCAACCAGATTAACGCTAACAACATGG
AAGACATTTTCCGTTTCTGCAACGTATACGTTGATCTGGACTTTGTGGTTTCAGAGACAAAGATGATATGGATGGATAGG
CTTGGATTCGACCTTCGAGTGTGGTCTCCACGAGGTGTATACGATGTCAGGATTCCATTTCCAATGGAAGTAACAGATGA
AAAAGGAGCCAAATCATCGTTTAATGGAATGTCACAGCTCGCTTGGGAAGTAGAGAAAAGTTATTACCCCGCAGATTTCA
ACAAGGTTAAACTACTTAAACCAGTAGTTGGATCATTACAAAAGGGACAATAG