Details for Kale Locus Bo5g103520

Position : C5 ( 5`- 32942756 .. 32944510 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g103520

Protein [Map View]
MHSMSKQKSATPLFLCPDAKFLSVEDEFHCIQFGELLSSSSDHIRPLHRKVNKTYAKFFNKCAVCGDQILHNLEPLMYIC
KEPSCHIPSLQHSFHRVCIEPISKHPYHPKHTLRLIFTDPIHKECLNIPCIIRISRHEHRISFNSSLTPEKLMCGVCHWK
IDTNYGRYSCVKGCNYGVHSKCATREDVWDGEELEGKPEDPYEDISSFIEISEGIIQHLSHQDHHMRLDEKTDRAFDENN
YCQACTLPICDDIIYSCMQCDFILHKECAQLPRKKHQVTHPHSLSLQVGHQGCALFECKACLRSSNGFAYLCDEEDCEYM
LDVRCASIAEPLDHRCHQHPLFLTFEPRSKQICSVCHKSRGHRLNCGECGFVACFGCATLPNKLRYKHDEHVLLFSYEEE
VNGQYFCEVCEKEANPKNGVYMCHDCNVTLHIKCLLGKDVNIMHGVVIEYPEVDVSILLNDRLSRNICKSCDKLCEHKIV
YEVSGFEICSLKCMNFVVLYFTMFA*

DNA
ATGCATTCTATGTCAAAGCAAAAAAGTGCCACTCCCCTTTTCTTATGCCCTGATGCAAAATTTCTAAGCGTAGAAGATGA
GTTTCACTGTATACAATTCGGAGAGTTATTATCATCTTCATCTGATCACATCCGACCTTTACATCGAAAGGTCAACAAAA
CGTATGCTAAATTCTTCAACAAGTGTGCAGTTTGCGGGGATCAAATACTCCACAATCTCGAGCCCCTGATGTACATCTGC
AAAGAACCTTCTTGCCATATTCCATCACTACAGCATAGTTTCCACAGAGTGTGTATCGAGCCGATATCAAAGCACCCATA
TCATCCTAAGCATACTCTCCGGCTTATTTTTACAGATCCAATCCATAAAGAGTGTCTAAACATTCCATGCATCATAAGAA
TATCACGTCATGAACACCGCATCTCTTTCAATTCTTCTCTTACTCCAGAAAAATTGATGTGCGGAGTGTGTCACTGGAAG
ATAGACACAAATTATGGAAGATATTCTTGCGTAAAGGGTTGCAATTATGGTGTTCATTCTAAATGTGCAACACGAGAAGA
TGTATGGGATGGAGAAGAACTTGAGGGAAAACCAGAAGATCCATATGAAGACATTAGCTCCTTCATTGAGATAAGTGAGG
GAATTATACAACATTTAAGTCATCAAGATCATCATATGAGACTCGATGAGAAGACCGATAGAGCTTTTGACGAGAACAAT
TATTGTCAAGCATGCACACTTCCCATATGTGATGATATTATTTACAGTTGCATGCAATGTGATTTTATCCTCCATAAAGA
ATGTGCACAGCTTCCTCGGAAGAAACACCAAGTGACTCATCCTCATTCCCTTAGTCTACAAGTGGGTCATCAAGGCTGTG
CATTGTTCGAATGTAAAGCTTGTCTTCGTTCAAGCAATGGATTTGCGTACTTATGTGATGAAGAGGATTGTGAGTATATG
TTAGACGTACGTTGTGCTTCTATAGCTGAGCCATTGGATCATCGGTGTCATCAGCATCCCTTGTTTCTTACATTTGAGCC
CCGATCTAAACAAATATGTTCGGTTTGCCACAAATCTCGAGGTCATCGTCTAAATTGTGGAGAATGTGGGTTTGTTGCAT
GTTTTGGATGTGCCACTTTACCCAATAAGTTGAGGTACAAGCATGATGAACATGTTCTTCTTTTTTCTTACGAAGAAGAG
GTAAATGGTCAATACTTCTGCGAAGTTTGTGAAAAAGAAGCAAATCCGAAGAATGGAGTTTATATGTGCCATGACTGCAA
CGTTACACTGCATATTAAATGTCTACTTGGAAAAGACGTAAATATTATGCATGGTGTAGTAATCGAGTATCCTGAAGTGG
ATGTTTCTATTCTTCTCAATGATCGCCTTAGTCGCAACATATGTAAAAGTTGCGATAAACTTTGTGAACACAAAATAGTA
TACGAAGTATCTGGTTTTGAGATATGTTCTCTCAAGTGTATGAATTTTGTTGTACTATATTTTACCATGTTTGCTTGA