Details for Kale Locus Bo5g103480

Position : C5 ( 5`- 32826654 .. 32827328 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g103480

Protein [Map View]
MMISYTSFESVVQLRTIFITGLPDDVKERELLNLLRWLPGYEASQVNFKGEKAHGFFSFLHGSVCIGSQRCSSEMAKKNL
FVKIVSLVLSPIIFHLGVLLLFCRKCWGFKVSGYELVVTAHSVYSPSPFHHLPPPVWGPPHGYSCQMVRP*

DNA
ATGATGATATCTTACACGAGTTTTGAATCTGTTGTTCAGCTTCGGACAATCTTCATCACGGGGCTTCCTGATGATGTAAA
GGAGAGGGAGCTTCTGAATCTCTTGAGATGGTTGCCTGGTTACGAGGCTTCTCAAGTGAACTTCAAGGGAGAAAAAGCCC
ATGGGTTTTTCTCGTTTCTCCACGGCTCAGTTTGCATTGGCAGCCAGAGATGCTCTTCAGAGATGGCCAAGAAGAATCTC
TTTGTTAAAATAGTTTCATTGGTACTATCGCCAATCATATTTCACCTTGGTGTTCTTTTGTTGTTTTGTAGGAAATGTTG
GGGATTCAAAGTAAGCGGTTACGAATTAGTGGTGACTGCACACTCTGTTTATAGTCCGTCTCCCTTCCACCATCTACCGC
CGCCAGTTTGGGGTCCACCTCATGGGTATAGCTGTCAAATGGTCCGTCCATAG