Details for Kale Locus Bo5g102350

Position : C5 ( 5`- 32650587 .. 32654938 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g102350

Protein [Map View]
MLCSLRVGATILIMPKFEITLLLEQIQRCKVTVAMVVPPIVLAMVKSSETEKYDLTSVRMIKSGAAPLGKELEDTISAKF
PNARLGQGYGMTEAGPVLAMSLGFAKEPFPVKSGACGTVVRNAELKIADPDTGSSLPRNSPGEICIRGHQIMKGYLNDPV
ATAATIDKEGWLHTGDIGFVDDDDELFIVDRLKELIKYKGFQVAPAELESLLISHSDINDVAVVAMKEDDAGEVPVAFVV
RSKESNLSEDEIKQFVSKQVVFYKRINKVFFTDSVPKAPSGKILGETTCRESFHLITTFEKQHRITEPTVYRNPLYHTGM
TPEPRTSTVFIELEDHRTLPGNLTPTTEEHLQRLYRRFWGFRQLQRTRRSFGERPGELGREPATPPRLHHHIPPLDSFTK
ESAKPPESKPATQRQRDSRIPESIFVNRKGKTKTKPPRLSVSQRV*

DNA
ATGCTATGTAGTCTCAGAGTCGGTGCCACTATTTTGATCATGCCCAAATTCGAGATCACTCTCTTGCTAGAGCAGATCCA
GAGGTGTAAAGTTACAGTGGCTATGGTCGTGCCACCGATCGTTTTGGCCATGGTGAAGTCTTCGGAGACGGAGAAGTATG
ATCTGACCTCGGTGAGGATGATTAAGTCAGGTGCGGCTCCTCTTGGTAAGGAGCTTGAAGATACCATTAGTGCTAAGTTT
CCTAACGCAAGGCTTGGTCAGGGCTATGGAATGACGGAGGCAGGTCCGGTGCTAGCAATGTCACTAGGGTTCGCGAAAGA
GCCGTTTCCGGTGAAATCAGGAGCATGCGGTACAGTCGTCAGAAACGCCGAGTTGAAGATCGCTGATCCAGACACTGGAA
GTTCCCTTCCTAGGAACAGTCCCGGAGAGATATGCATCCGCGGCCACCAAATCATGAAAGGCTACCTCAATGACCCGGTG
GCCACAGCAGCAACGATAGACAAAGAAGGTTGGCTTCACACCGGAGACATTGGATTTGTCGACGATGACGACGAGCTTTT
CATTGTCGATCGCTTGAAAGAGCTTATCAAGTACAAGGGATTCCAGGTGGCTCCGGCGGAGCTCGAGTCTCTCCTCATCT
CTCACTCGGACATCAATGATGTTGCAGTGGTCGCCATGAAAGAAGACGATGCTGGTGAGGTTCCTGTTGCTTTTGTGGTG
AGATCCAAAGAGTCAAATTTATCAGAAGATGAAATTAAGCAATTTGTGTCAAAACAGGTTGTGTTTTACAAGAGAATCAA
CAAAGTTTTCTTCACTGACTCCGTTCCTAAAGCTCCATCAGGGAAGATATTGGGGGAGACCACGTGTCGCGAAAGCTTCC
ACCTCATCACCACTTTCGAGAAACAACACCGGATAACTGAACCGACGGTTTACCGGAATCCGCTGTATCACACCGGAATG
ACACCAGAACCTCGAACCTCCACCGTTTTCATCGAGTTAGAAGACCACCGGACTCTACCGGGAAACTTGACCCCTACCAC
CGAAGAACACCTCCAACGACTGTATCGGAGGTTTTGGGGATTCAGACAGCTGCAACGCACACGCCGGAGCTTCGGAGAGC
GTCCGGGAGAACTCGGTAGAGAGCCAGCGACACCGCCAAGGCTACACCACCATATACCACCGCTGGATAGTTTCACCAAA
GAGAGTGCGAAACCACCAGAGTCTAAGCCGGCTACACAGCGTCAGAGAGACAGCCGTATACCAGAGTCGATATTCGTTAA
CCGGAAAGGTAAGACAAAGACGAAACCACCGCGACTCTCTGTCTCTCAAAGGGTCTAG