Details for Kale Locus Bo5g102290

Position : C5 ( 5`- 32587439 .. 32592927 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g102290

Protein [Map View]
MAVLIEDLPWCDVELNLGSKCLQRTAIDLVNLLFLSFFYLLLVAGCVSQRFTLGSRKKGWIFVAAAICCAATSIIYLGAG
LKNLIASANDEVSWVACFVEGLIWVSLTVSLLVNGSKWIKILASVWWVSFALLDSAAKIEILSQGKSIRMFDIITWLISL
LLLLCSWMNLRSSPEAQDYSTAGLSDPLLAENSKKNSARLATARFFSFLSFSWMNSLLSLGFKKPLTPDDIPSVVPEDEA
ELAYTKFSKAWDDALLSEPEGAKERNLVFRAVAKVYFKENILTAVCALFRTIAVVSLPLMLYVFVDYANSDHRDLRTGFF
NLACLVMLKLVESLSMRHWYFAARRSGMRIRSALMVAAYKKQLKLSSLGRKRHSSGEIVNYIAVDAYRMGEFLWWFHSGW
SLTLQLLLSTAVLFGVVGIGAVPGLILLLLCGLLNLPFAKMLQNCQTQFMIAQDKRLRSTSEILNSMKVIKLQSWEEEFK
KQIESCRDEEFKWLAKAQLTKAFGTFLYWMSPTIVSSVIFVGCALMNSAPLNASTIFTVLATLRVMSEPVRVIPEAISAI
IQVNVSFDRINNFLLDDELKTDEIGRSGMEKSGTAVDIQAGNFSWDPETKHPTLRNINLEIKNGQKVAVCGPVGAGKSSL
LHAVLGEIPKVSGTVKVSGSIAYVSQTSWIQSGTIRDNILYGKPMETRRYNAAIKACALDKDINDFGHGDLTEIGQRGLN
LSGGQKQRIQLARAVYADADVYLLDDPFSAVDAHTAGVLFHKCVEDSLREKTVILVTHQVEFLSEVDQILVMEEGRITQL
GKYDELLMMGTAFKQLVNAHNDAVTVLPLASNESLGDLTKVGRDREIGNIQVVEKIEEEITTTTNVPGAQLTQEEEKEAG
YVGLKPFLDYLNVSRGWFLLSSSVLGQVGFVVFQAASTYWLAYGIGIPNLTATMLIGVYSVISTLSAGFVYARAVTTAHL
GLKASKAFFSGFTNAVFKAPMLFFDSTPVGRILTRASSDLNVLDFDIPFAIIFVVSPAVELTAALIVMTYVTWQVIIIAL
LALAATKVVQEYYLASARELIRINGTTKAPVMNYAAETSLGVVTIRAFGTVDRFLKNYLSLVDADAVLFFLSNAAMEWVI
LRIETLQNLTLFTCALLLILIPKGYIAPGLVGLSLSYALTLTQTQVFLTRWYCTLSNSIISVERIKQYMSIPAEHPAVVD
DKRPPSSWPSSGTIHLQELKIRYRPNAPLVLKGISCTFREGTRVGVVGRTGSGKSTLISALFRLVEPASGCILIDGIDIS
KIGLKDLRMKLSIIPQEPTLFRGCIRTNLDPLGVYSDDEIWKALEKCQLKATISNLPNKLDSSVSDEGENWSVGQRQLFC
LGRVLLKRNKILVLDEATASIDSATDAIIQRIIREEFADCTVVTVAHRVPTVIDSDMVMVLSFGDLVEYNEPSKLMETDS
YFSKLVAEYWASCRGNSSQNLQVHI*

DNA
ATGGCGGTTTTGATTGAGGACCTTCCATGGTGTGACGTTGAACTGAATCTTGGCTCTAAATGCTTACAGAGAACGGCCAT
AGATCTCGTTAATCTACTGTTCCTCTCCTTCTTCTACTTGCTCTTGGTAGCTGGTTGTGTTTCACAGCGTTTTACTCTTG
GGAGCCGCAAAAAAGGCTGGATCTTTGTTGCTGCAGCTATATGCTGTGCTGCTACTAGCATTATATATCTTGGTGCTGGA
CTGAAGAATCTGATTGCTAGTGCCAATGATGAAGTCTCCTGGGTTGCTTGCTTTGTTGAAGGGCTCATTTGGGTCTCACT
TACGGTTTCACTGCTTGTTAACGGCTCCAAGTGGATCAAGATTCTCGCATCGGTTTGGTGGGTGTCTTTTGCTTTGCTGG
ATTCAGCAGCAAAGATTGAGATACTTTCTCAGGGGAAAAGCATCAGAATGTTTGACATCATTACCTGGCTGATAAGCCTT
TTGCTTCTTCTTTGCTCCTGGATGAACTTGAGATCTTCTCCAGAAGCTCAAGATTACAGCACAGCAGGTCTTTCTGATCC
TTTATTAGCTGAGAATTCTAAGAAAAACTCGGCAAGGTTAGCAACAGCTAGATTTTTCAGCTTTCTATCCTTCTCTTGGA
TGAACTCTTTACTCTCGTTGGGCTTCAAGAAACCATTAACCCCAGACGATATCCCAAGTGTTGTCCCGGAGGATGAGGCT
GAGTTAGCTTACACTAAATTCTCCAAAGCATGGGATGATGCTCTTCTCTCAGAGCCAGAGGGAGCCAAGGAAAGAAACTT
GGTGTTCAGAGCCGTTGCAAAAGTCTACTTCAAGGAGAACATACTCACAGCAGTTTGTGCACTCTTCCGAACAATAGCTG
TAGTATCTCTTCCACTAATGCTATACGTCTTTGTGGATTACGCAAACAGTGACCACCGTGATCTCCGCACTGGTTTCTTC
AACTTAGCTTGTCTAGTTATGCTGAAGCTTGTTGAGTCCTTGTCAATGAGACACTGGTACTTTGCAGCAAGAAGATCAGG
GATGAGGATTAGATCAGCGCTGATGGTCGCTGCGTATAAAAAGCAGCTGAAGCTATCAAGCTTAGGGAGGAAAAGGCATT
CGTCTGGAGAGATTGTGAACTACATCGCCGTGGATGCGTACCGAATGGGAGAGTTCTTGTGGTGGTTCCACTCAGGATGG
AGCCTTACGCTGCAGCTTTTGCTTTCCACAGCTGTACTTTTCGGAGTAGTTGGAATAGGAGCTGTTCCAGGTTTGATTCT
TCTTCTCCTCTGCGGTCTTCTTAATCTCCCGTTTGCAAAGATGCTGCAGAACTGCCAGACCCAGTTCATGATCGCGCAGG
ATAAACGATTAAGATCCACTTCGGAGATTCTGAACAGTATGAAAGTCATTAAGCTGCAGTCATGGGAAGAGGAGTTCAAG
AAACAGATAGAGTCTTGCCGTGATGAGGAGTTCAAATGGTTGGCTAAGGCTCAGCTGACAAAGGCCTTTGGTACTTTCTT
GTATTGGATGTCTCCAACAATAGTTTCTTCTGTTATCTTTGTGGGGTGTGCTTTAATGAACAGCGCGCCGCTGAACGCAA
GCACCATCTTCACGGTTTTAGCTACGCTGAGAGTTATGTCAGAGCCGGTTAGAGTTATACCTGAGGCGATTTCTGCTATC
ATCCAAGTGAACGTCTCTTTTGATAGGATCAACAACTTTTTGCTTGATGATGAGCTCAAGACCGACGAGATTGGAAGAAG
TGGTATGGAGAAGTCTGGAACAGCAGTTGATATACAAGCAGGAAACTTCAGTTGGGATCCAGAAACTAAGCATCCAACTC
TTCGAAATATAAATTTGGAAATTAAGAATGGGCAAAAAGTTGCTGTTTGTGGACCAGTTGGTGCAGGTAAATCGTCTCTG
TTGCATGCAGTGCTCGGAGAAATACCTAAAGTTTCAGGAACTGTAAAGGTCTCTGGGTCCATCGCTTATGTTTCTCAGAC
CTCTTGGATCCAAAGTGGTACCATCAGGGATAACATCCTCTATGGGAAGCCAATGGAAACTAGACGATATAACGCTGCTA
TTAAAGCATGTGCTTTGGATAAGGACATAAATGATTTTGGACATGGTGACCTCACAGAGATAGGACAAAGAGGGCTTAAC
TTGAGCGGAGGGCAAAAGCAAAGGATTCAGCTGGCACGTGCTGTTTATGCAGATGCTGATGTTTACCTCCTTGATGATCC
TTTTAGTGCTGTTGATGCACATACAGCTGGAGTTCTTTTTCATAAATGTGTTGAGGACTCGCTGAGGGAGAAAACTGTCA
TTCTGGTCACTCACCAAGTTGAATTCCTCTCAGAAGTTGATCAAATTCTGGTTATGGAAGAAGGAAGAATCACTCAGTTA
GGAAAGTATGATGAGCTCTTAATGATGGGAACGGCATTCAAACAGCTGGTGAATGCTCATAACGATGCAGTAACTGTGTT
ACCTTTGGCTAGTAATGAAAGCCTAGGAGATCTTACCAAAGTGGGCAGAGACAGAGAGATAGGAAACATCCAGGTTGTAG
AGAAAATCGAAGAAGAGATCACAACAACAACCAATGTTCCAGGGGCACAACTTACGCAGGAAGAGGAAAAAGAGGCGGGC
TATGTTGGATTGAAACCTTTCTTGGACTATTTAAATGTCTCCAGAGGATGGTTTCTTCTGTCGTCAAGCGTATTGGGTCA
GGTAGGCTTTGTAGTTTTTCAAGCCGCATCAACATACTGGCTGGCTTATGGAATTGGGATCCCTAATCTCACAGCAACAA
TGCTTATTGGAGTCTATAGCGTCATCTCAACTCTTAGTGCTGGTTTTGTATACGCGAGAGCTGTAACGACTGCCCATCTT
GGACTAAAAGCTTCTAAAGCTTTCTTCTCTGGTTTCACAAATGCAGTCTTCAAAGCACCAATGCTTTTCTTTGATTCTAC
TCCAGTTGGACGCATTCTCACCCGAGCATCATCTGATTTAAACGTCTTGGACTTTGACATTCCATTTGCAATCATATTTG
TGGTATCACCTGCTGTCGAGCTCACTGCTGCTCTAATCGTCATGACATATGTGACATGGCAAGTTATCATTATCGCTCTT
CTTGCTTTAGCGGCCACGAAAGTTGTTCAGGAGTACTATTTAGCCTCCGCAAGGGAGCTTATTAGGATCAATGGAACAAC
GAAAGCTCCAGTGATGAACTATGCTGCAGAAACCTCGCTTGGAGTGGTGACAATAAGAGCTTTTGGAACTGTAGATAGAT
TCCTTAAAAACTACCTAAGCCTGGTGGATGCAGATGCTGTGCTGTTCTTTCTGTCTAATGCAGCCATGGAGTGGGTGATT
CTGAGGATAGAGACTCTTCAGAATTTGACTTTGTTCACTTGTGCACTTCTGCTTATCCTTATTCCCAAGGGCTACATAGC
TCCAGGTCTTGTTGGGCTTTCACTATCCTATGCACTAACACTGACACAAACTCAGGTGTTTCTAACCAGATGGTATTGTA
CCTTATCAAATTCAATCATTTCGGTAGAGAGGATAAAACAGTATATGAGCATACCAGCAGAGCATCCTGCTGTTGTTGAT
GATAAAAGGCCACCTTCCTCATGGCCATCCAGTGGTACCATTCACTTGCAGGAACTTAAGATAAGATACCGGCCCAATGC
TCCCTTGGTTCTCAAAGGAATCTCTTGCACATTCAGGGAAGGGACAAGAGTGGGAGTTGTGGGGAGAACGGGAAGTGGGA
AAAGCACGTTGATCAGTGCTTTGTTCCGGTTGGTAGAACCAGCAAGTGGTTGTATATTGATTGATGGCATTGACATAAGT
AAGATTGGTCTAAAAGACCTGAGAATGAAACTCAGCATCATTCCTCAAGAACCAACTCTCTTCCGTGGCTGCATAAGGAC
CAACCTTGATCCTTTAGGTGTTTACTCCGACGATGAAATATGGAAGGCTCTTGAGAAGTGTCAGCTTAAGGCCACCATTA
GCAATCTACCTAATAAACTTGATTCTTCAGTGAGTGATGAAGGAGAGAACTGGAGCGTGGGACAGAGGCAGCTGTTCTGT
CTTGGAAGAGTCTTATTAAAGAGAAACAAAATATTGGTGTTGGATGAAGCTACGGCTTCCATAGATTCAGCCACTGATGC
CATCATCCAGAGAATCATAAGAGAGGAGTTCGCAGATTGCACGGTGGTAACAGTTGCACATAGAGTTCCAACGGTTATAG
ATAGTGACATGGTCATGGTTCTCTCCTTTGGTGATCTTGTGGAGTACAACGAGCCTTCAAAGCTGATGGAGACTGATTCT
TACTTCTCCAAGCTCGTTGCTGAGTATTGGGCAAGCTGCAGAGGAAACTCTTCTCAGAATCTACAAGTTCACATCTAA