Details for Kale Locus Bo5g102280

Position : C5 ( 5`- 32583852 .. 32585439 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g102280

Protein [Map View]
MKRKRCDMEEATKKKKMTEIGSAIEELSLLSIAKTTIVTTKIEATNIINLPLKPLLSFCKLIVQVLDKIGPTMAVLRQDI
DQNIQRLEKMWETDPIVYSNLVEILRKEAKEGSSKKPKSCSRAAVWLNRAMDFTLALLQRLVKDMSQNMQQAVEESYNST
IKPWHGWISCAAFKVALKLVPNNNTFINVLAGKDESYQMVQDDIRSLISLLIPLLSQLHSILELYEVHKLKST*

DNA
ATGAAACGAAAGAGATGTGACATGGAAGAGGCAACCAAGAAGAAGAAGATGACAGAGATTGGATCGGCCATTGAAGAACT
CTCTCTTCTTTCCATAGCCAAGACCACAATAGTTACTACCAAAATAGAAGCCACCAACATCATCAATTTACCTTTGAAGC
CTCTCCTCTCTTTCTGCAAATTAATCGTCCAAGTTCTTGATAAGATTGGCCCGACAATGGCTGTTCTCCGACAAGACATT
GATCAAAATATTCAAAGATTAGAGAAGATGTGGGAAACTGATCCTATCGTGTACTCAAATTTGGTTGAGATATTGAGAAA
AGAAGCGAAGGAAGGATCTTCTAAGAAGCCTAAAAGCTGCAGCAGAGCTGCTGTTTGGCTAAACAGAGCGATGGATTTTA
CATTGGCCCTATTGCAACGGCTTGTCAAAGACATGTCACAGAACATGCAACAAGCCGTCGAAGAAAGTTATAATTCGACT
ATAAAACCTTGGCATGGATGGATCTCTTGTGCTGCTTTCAAGGTTGCTCTTAAGCTGGTACCAAACAACAACACATTCAT
CAACGTGCTTGCGGGTAAAGACGAGAGTTACCAGATGGTTCAAGATGATATAAGAAGTTTGATTTCTTTGCTCATTCCAC
TTCTAAGCCAGCTCCATTCTATTTTGGAATTATACGAAGTGCACAAACTAAAGTCAACATGA