Details for Kale Locus Bo5g101260

Position : C5 ( 5`- 32532129 .. 32532701 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g101260

Protein [Map View]
MQDPSAYYNSMMATQQQQQPQQFPEQEQLKCPRCDSPNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGALRNVPVGGGSRK
NAKRSTSASSPPNTHKKKTKHPDPDPNPDTDPTRMLYGFPIGDQDVKGMEMGGGGSFSSLLASNMQLGLGGIILDGSGWD
PGMGLKRSEAGDEGGGNPWTDLSRNRVEKN*

DNA
ATGCAGGATCCATCAGCTTATTACAACTCGATGATGGCGACACAACAACAACAACAACCACAGCAGTTTCCAGAGCAAGA
ACAGCTAAAGTGTCCTCGATGTGACTCACCGAACACAAAATTCTGTTACTACAACAACTACAACCTGTCACAGCCCCGTC
ACTTTTGCAAAAGCTGCCGTCGTTACTGGACCAAAGGCGGGGCTCTCCGCAACGTTCCCGTCGGCGGCGGTTCTCGCAAG
AACGCTAAACGATCAACCTCTGCGTCTTCTCCTCCCAACACACACAAGAAGAAGACCAAACACCCGGACCCGGATCCTAA
CCCGGATACGGATCCGACCCGGATGCTGTACGGGTTTCCGATCGGAGACCAAGACGTGAAAGGTATGGAGATGGGTGGTG
GTGGGAGTTTTAGCTCGCTTTTGGCGTCGAATATGCAGTTGGGTCTTGGTGGGATCATCCTAGACGGGTCGGGTTGGGAT
CCGGGTATGGGACTAAAGAGGAGTGAAGCGGGTGACGAAGGTGGTGGTAACCCGTGGACCGATCTTTCTAGGAACAGAGT
GGAGAAAAACTGA