Details for Kale Locus Bo5g101250

Position : C5 ( 5`- 32520109 .. 32520856 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g101250

Protein [Map View]
MRTLKNISCSRRYSDLHQGVSYIFVAKKRESYKKAKNLRVWKLSVLVGYPLELDIFDLCSEDRRKKFEAPRQCKEQLKGP
QCEMTDVEIFFLYFSGSSSGTGKSSTSDQHGGIFSEEHLFNIFFV

DNA
ATGAGAACTTTAAAAAACATCTCCTGCTCTAGGAGGTACAGTGATTTACATCAAGGAGTCTCTTATATATTCGTTGCCAA
GAAAAGGGAGAGTTATAAGAAAGCAAAAAATCTCCGGGTATGGAAGCTTTCTGTTTTAGTGGGTTATCCATTGGAGTTGG
ATATCTTTGACCTTTGTTCCGAGGATCGTCGAAAGAAATTTGAAGCTCCTCGCCAGTGCAAAGAGCAGCTCAAAGGGCCA
CAGTGTGAAATGACTGATGTTGAGATCTTTTTTCTCTATTTCTCTGGATCATCAAGCGGAACTGGCAAATCATCCACAAG
CGACCAACACGGAGGTATATTCTCTGAAGAACACCTTTTCAACATCTTTTTTGTC