Details for Kale Locus Bo5g101240

Position : C5 ( 5`- 32511974 .. 32517864 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g101240

Protein [Map View]
MSYGGSSKPGRGRGGGVGGGGGGGGPGRNRNSFPPLTNRHPSPVGRMSTGGGGSSAAPRQRNTTSVKAAAAASSSRAVEE
KFSLVPRESPPAFGMIIRLTPDLVDEMKRVEAEGGAAKIKFDAFPNNSTGNIIDVGGKEFKFTWSGERGDLCDIYEEHQS
GEDENGVLIEAGSAWRKLNVQRTLDESTTSQMKMRSVEAEQRTKSRKAIVLDPGNPSLKKQLARAEASPWRMSNNQKKEP
PPKKRKVDPPPVPIGGPKPSFRPGVSTTSVKNRLSASPGPSPSNQYNTPSSYGTGNIAKTHADNVNVTPVNTKGRERIVA
SEKDLSTWERNALRDTSERQETNVNKEIDLQALLVDLLKEAPMSLKALEKAVGDRTPNASKKIEPILKKIANFQAPRYFL
KPEADLDSRSSPEHQQLLPITECNRDQLPVPGVSNMETFSVCERKGEGLQECSPLPLGEHLSTQENVDIEHHSPGILHEE
KRSENRNGQVRSSSSDSDSDNSGSSSDSGSSSDSDASSNSKEVSDEDVDIMSDGDKEPRQTIDIEGNDSDAVDIDGHSSD
EGHGSEADRKNEVGISEQEKLPSGHDKLRERQNFIGQLFDDTDNTTKDSLKSDQPGISERLAKDQNQISPALEHYSQQSA
RERNVKSQQLPAIGKEDSQPSERKNDLQHLNASASQMIDPLKGLRKSSTEKLSRHGQMKPGDSSGKSNKHSDALGDVRKA
DEDDHFPHETLSSRSGKAFRDNHRDAVHSKNKFARNKKDGESSIGPSFPSDRANRKHGELDGSEKDPKNVSGLGMGSSPL
DSQRAKLPKGNGSILQKQVSDLELGELPESLEVDTAVKELEDKTCFRQSNFKPSTSEKLGIDSDKRRSKKSSKKQALTHA
GNGTKELPQQVVDDSERSQKLALQSHEQNHTGTDTENGSHYNNLEDAAYKSRKRYSRGRVVSSVEGYGETNKKTPVIKQG
SERPSTSRSSRESKRHKNATSMNGHKDATFDAEDSSYLKYEKASPDHKGPIRDHLQYKAYMQEYLDKYDDYCSINKILES
YRNDFQKLGEDLKLTKGRDMVRYNKIVDDLNESYRKYGERHKRLKKVFIVLHEELKQLKERMKDYASSHGKD*

DNA
ATGAGTTACGGAGGATCGTCGAAACCCGGTCGCGGTAGGGGTGGAGGAGTAGGAGGCGGCGGCGGTGGTGGTGGACCGGG
CCGAAACCGCAATTCGTTCCCACCTCTCACCAACCGACATCCTTCCCCCGTCGGGAGGATGTCCACCGGTGGTGGTGGCT
CCTCGGCCGCCCCACGACAGAGGAATACTACCAGCGTCAAGGCGGCGGCCGCGGCGTCGTCTTCTCGTGCCGTTGAGGAA
AAGTTTAGCCTGGTTCCGAGGGAGAGTCCACCGGCTTTTGGAATGATAATACGGTTAACTCCTGACTTGGTGGATGAGAT
GAAGCGCGTGGAGGCAGAAGGTGGAGCCGCCAAGATCAAGTTCGATGCGTTTCCGAACAATAGCACTGGGAATATAATCG
ATGTTGGTGGAAAGGAGTTCAAATTTACCTGGTCAGGGGAGCGTGGTGATTTATGTGATATCTATGAGGAACACCAAAGT
GGTGAAGATGAAAATGGTGTGCTGATTGAGGCTGGATCTGCTTGGAGAAAATTGAACGTCCAGCGAACTCTAGATGAGTC
AACCACAAGCCAGATGAAGATGCGCTCAGTCGAAGCTGAACAGAGGACCAAATCGCGCAAGGCAATTGTTTTAGATCCTG
GGAATCCATCATTGAAGAAGCAATTAGCTCGTGCTGAAGCAAGTCCATGGAGAATGTCAAATAACCAGAAGAAGGAACCT
CCGCCTAAGAAGCGGAAAGTCGATCCACCTCCAGTTCCAATCGGAGGTCCAAAGCCTTCTTTCAGACCAGGGGTTTCAAC
CACTTCTGTGAAGAATAGGCTTTCAGCTTCACCTGGACCATCTCCTTCTAATCAATACAATACCCCTTCTTCATATGGGA
CTGGGAATATTGCTAAAACTCATGCAGATAACGTGAATGTCACACCAGTCAACACAAAGGGCAGAGAGAGAATTGTTGCT
AGCGAAAAGGATTTATCAACCTGGGAAAGAAATGCTTTAAGGGACACATCTGAACGCCAAGAAACCAATGTTAATAAAGA
AATTGACTTGCAGGCACTGCTAGTTGATCTCCTAAAAGAGGCTCCAATGAGCTTGAAGGCTTTAGAGAAAGCTGTTGGAG
ATAGAACCCCTAATGCGTCAAAGAAGATTGAGCCAATTTTGAAAAAAATTGCAAATTTCCAAGCTCCAAGGTATTTCTTA
AAACCAGAAGCAGATTTGGATAGCAGAAGTTCACCTGAACACCAGCAACTGCTTCCAATCACTGAGTGCAATCGCGACCA
GTTACCTGTTCCAGGGGTTAGCAACATGGAGACCTTTTCTGTGTGCGAGCGGAAAGGAGAAGGTTTACAAGAGTGTTCAC
CTTTGCCTCTGGGAGAGCATCTGAGTACGCAAGAAAATGTTGACATTGAGCATCATTCACCTGGTATTCTTCATGAGGAA
AAGCGATCTGAGAATAGAAATGGCCAGGTTCGTAGCTCTAGTAGCGACAGTGATAGTGATAATAGTGGGAGCAGCAGTGA
TAGCGGGAGCAGCAGTGATAGCGATGCTTCTTCTAACAGCAAGGAAGTTTCTGATGAGGATGTGGATATAATGAGCGATG
GTGACAAAGAGCCCCGACAGACAATTGACATCGAGGGTAATGATTCTGATGCCGTGGACATCGATGGTCACAGTTCAGAT
GAGGGTCATGGTTCTGAAGCTGACAGGAAGAATGAAGTTGGCATTTCAGAGCAGGAAAAACTACCTTCTGGTCACGACAA
GCTACGAGAGCGCCAAAATTTTATTGGACAGTTGTTTGATGACACAGATAATACTACGAAGGATAGCTTAAAAAGTGACC
AGCCTGGCATCTCTGAGAGGCTGGCCAAAGACCAGAACCAAATATCCCCTGCTTTGGAGCACTACAGTCAGCAATCAGCA
CGGGAGAGAAACGTAAAATCCCAGCAATTGCCTGCCATAGGTAAAGAAGATTCACAGCCTTCAGAGCGCAAGAATGATTT
ACAACATCTGAACGCTTCTGCTAGTCAAATGATTGATCCACTAAAAGGACTTCGGAAGTCATCTACTGAAAAGTTGAGTA
GACATGGTCAAATGAAGCCTGGTGATAGTTCAGGTAAATCAAACAAACATTCTGATGCCTTGGGTGATGTTCGTAAAGCT
GACGAAGATGACCATTTTCCGCATGAAACCCTTTCTAGTCGGTCAGGAAAGGCCTTCAGAGACAATCATAGGGATGCTGT
TCATTCAAAAAATAAGTTTGCAAGGAATAAAAAAGATGGTGAGTCATCCATTGGACCTTCATTTCCTTCTGACAGAGCCA
ACAGAAAACACGGTGAACTGGATGGAAGTGAGAAGGATCCCAAGAATGTTTCAGGCTTGGGCATGGGTTCCTCTCCATTG
GATAGCCAGAGAGCAAAATTACCTAAGGGAAATGGATCTATTCTCCAAAAACAAGTTTCGGACTTGGAGTTGGGTGAACT
CCCTGAGTCATTGGAGGTAGATACAGCAGTGAAGGAACTCGAAGATAAAACTTGTTTTAGGCAGTCAAATTTTAAACCAA
GCACTTCAGAAAAGTTGGGTATTGACTCAGATAAACGGAGGTCTAAAAAATCTTCAAAAAAACAAGCTCTTACACATGCT
GGCAATGGTACAAAAGAATTGCCCCAACAAGTTGTTGATGATTCAGAAAGATCCCAAAAGTTGGCTTTGCAGTCACATGA
GCAGAACCACACGGGTACAGACACTGAAAACGGCTCACATTACAATAATTTAGAGGATGCAGCTTATAAATCAAGAAAGA
GATATAGTAGAGGAAGAGTAGTAAGCAGTGTGGAAGGTTATGGAGAGACGAACAAAAAAACACCCGTTATAAAGCAGGGC
TCCGAACGACCATCCACATCCCGCTCATCAAGGGAGAGCAAAAGACACAAAAATGCAACTTCTATGAATGGACACAAAGA
TGCAACTTTTGATGCAGAAGACTCTTCTTATTTGAAATACGAGAAAGCCTCTCCCGACCATAAGGGGCCTATTAGGGATC
ATTTGCAGTATAAAGCATACATGCAGGAATATTTGGATAAATATGATGATTACTGCTCCATTAACAAGATATTAGAGAGC
TACAGAAATGACTTTCAAAAGTTGGGGGAAGACCTTAAGCTTACAAAAGGAAGAGACATGGTGAGATATAACAAAATTGT
TGACGACTTGAACGAATCTTATCGCAAATATGGAGAGAGGCACAAACGTTTGAAGAAAGTGTTTATTGTTCTCCATGAAG
AATTGAAGCAACTGAAAGAAAGAATGAAAGACTATGCATCATCTCACGGGAAAGATTGA