Details for Kale Locus Bo5g101230

Position : C5 ( 5`- 32506371 .. 32508736 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g101230

Protein [Map View]
MGSSDERNSKAIDASVGGLVWVRRRNGSWWPGRIMAHHEVPDDTIVSPKSGTPIKLLGREDAGVDWYNLEKSKRVKAFRC
GEYDACIETAKATATGASKKPVKYARREDAIVHALEIENALLVGKDEKASTSSDSTEGALQSSVSCEKTSNGESSKVLPL
SGKRSKTTPSDSEDDGSAGNKRMRGLEDLGVSIGSNGEANKQENDEEDISDSMPNGVLANGTSRGSSPSMKGIKRSPVVN
ANENSKKKNQRPRPPAKVLESTATASVPVSENKVSAVINNNNSDSNGVSCENDDVTLNASQVMMHNKAKETEISSISVSA
KDEVFDVPLLGEEKHSAGTSEAAFTFSHTKALALVSEPTRQCDDVVKTEGCNGFACISPSALLINGIEDITSKWQIKGKR
NPRQMSKKQEERRLAYAEEANNNYLPHCSLSDQNPHGVHFSGMGRNSQLYDVKIEEKGSYKPRNVPMISLMSKLDGEAIV
GHPLTLEVLQDGSCDRILCSHIKSLVVPMVAGDAKPKPSWKNKSKKKKPHIPPHKSSKSKKASSLSIKTRCLSALSGKKL
TVSSKKKVMIEKTREGIVSCIPLKVVFSRINEAVKGSARQVHRALPSSGNNTT*

DNA
ATGGGGAGTAGTGATGAGCGAAACAGTAAGGCGATTGATGCCTCCGTTGGAGGTTTGGTTTGGGTCCGACGCCGTAACGG
GTCTTGGTGGCCGGGTCGGATCATGGCTCATCACGAGGTTCCTGATGATACCATCGTTTCTCCCAAATCAGGCACACCTA
TTAAGCTTCTAGGTCGTGAAGATGCTGGCGTGGATTGGTATAATCTTGAAAAGTCCAAGAGGGTGAAGGCGTTTCGTTGT
GGGGAGTATGATGCCTGTATTGAGACTGCTAAGGCTACTGCCACTGGTGCTAGTAAGAAGCCTGTCAAGTATGCTCGACG
GGAAGACGCCATTGTCCATGCTCTCGAGATCGAGAATGCCCTCCTTGTTGGAAAAGATGAGAAGGCAAGCACGTCTTCTG
ACTCGACTGAAGGTGCGTTGCAGTCTAGTGTGTCTTGCGAAAAGACTAGTAATGGCGAATCTTCAAAGGTGCTGCCTTTG
TCAGGAAAGAGGAGTAAAACAACACCTAGTGACTCCGAAGATGATGGGAGTGCAGGAAACAAACGAATGAGAGGCCTTGA
GGATCTTGGAGTTAGTATAGGATCAAACGGAGAGGCTAATAAGCAGGAAAATGATGAAGAAGACATCAGTGATTCTATGC
CGAATGGGGTTCTTGCAAATGGTACTAGCAGGGGTAGCTCTCCGTCAATGAAAGGTATAAAAAGGTCACCAGTTGTCAAT
GCTAATGAGAACTCTAAAAAGAAAAACCAACGACCGCGGCCACCGGCAAAAGTGTTAGAGAGTACTGCTACGGCTTCTGT
TCCTGTCTCTGAAAACAAAGTTTCTGCTGTAATCAACAATAATAACTCTGACAGCAATGGGGTTTCGTGTGAGAATGATG
ATGTTACATTAAATGCTTCCCAAGTGATGATGCATAACAAGGCAAAAGAGACTGAAATCTCCAGCATATCAGTTTCGGCA
AAGGATGAAGTATTTGATGTTCCCCTACTTGGAGAAGAAAAACACTCTGCAGGTACTTCAGAGGCAGCTTTCACATTTTC
ACACACGAAAGCTCTGGCTCTTGTTTCTGAACCAACGAGGCAATGTGATGATGTGGTGAAAACGGAAGGATGTAATGGAT
TTGCTTGTATAAGTCCATCTGCTTTACTTATCAATGGGATTGAGGATATCACTTCCAAGTGGCAGATAAAGGGGAAAAGG
AACCCAAGGCAGATGAGTAAAAAACAAGAGGAAAGAAGACTTGCTTACGCCGAAGAAGCCAACAACAATTATCTGCCTCA
TTGTTCTCTCTCTGATCAAAATCCACATGGTGTTCATTTCAGCGGTATGGGAAGAAATTCTCAACTGTACGACGTGAAGA
TCGAGGAAAAAGGCAGCTACAAACCCAGGAACGTCCCGATGATTTCCCTTATGAGTAAACTGGACGGTGAAGCTATTGTC
GGTCATCCTCTAACCCTTGAAGTGCTTCAAGATGGATCGTGTGACCGCATTTTGTGCAGTCATATCAAGTCGCTTGTTGT
TCCAATGGTTGCCGGTGATGCGAAGCCGAAACCATCTTGGAAGAATAAATCCAAGAAAAAGAAACCACACATTCCTCCGC
ACAAATCATCAAAGTCAAAGAAAGCTTCGTCCCTATCCATAAAGACAAGATGCCTCTCTGCTCTAAGTGGCAAGAAGCTG
ACAGTGAGTAGCAAGAAGAAAGTGATGATTGAGAAGACGAGAGAGGGGATTGTGTCTTGCATCCCTCTGAAAGTAGTCTT
CAGTAGGATAAACGAAGCAGTGAAGGGGTCAGCGAGACAAGTACATAGAGCATTGCCATCTTCTGGCAATAATACTACAT
GA