Details for Kale Locus Bo5g101210

Position : C5 ( 5`- 32502375 .. 32504981 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g101210

Protein [Map View]
MKMTNSPFITTSEKVAFEHSPTSTPMLATAPAHALRLRYVAPSRLWFHKFRCSSSSSSSAVPLANLSDSELSGGNNTLKA
NEDKNNSEKKTAPYYPKRGQTVELVCESLGFKGKGICKVDGTGFVVMCDRALPGERFLGRVTRRKGSYAEVTKIKTLTPH
RDLVEAPCEYASYCGGCKAQNLSYEAQLRAKEEQVHELITHVGRFSDNNPGLETVLKPIVPCDIQFNYRNKMEFSFGPQR
WLPVEMLHEREDGPMSFALGLHAPGFFDKVLNVDKCLLQSEPANMVLAAVQDCWRDPELNLSPYNARSHAGFLKHLMLRT
GRNVETGSQELMVNFVTSSYKPELLKPLVDKVSSIPEVVSIMNNVNSSVGNTSVGEQEYTLYGKETIAEVLRDLTFQISA
NSFFQTNTHQAEVLYKLIEECAGLKGDGSEVVLDLFCGTGTVGLTLARRAKHVYGYEVVPQAITDAHKNAQINGIENATF
IQGDLNKIGEDFGSNFPKPDIVISDPNRPGMHMKLIKFLLNLKSPRIIYVSCNPATCARDLDYLCHGVEEKNIKGCYKLM
SVQPVDMFPHTPHIECVCLLELS*

DNA
ATGAAGATGACCAATTCACCCTTTATCACAACATCTGAGAAAGTCGCTTTCGAGCACTCCCCCACATCGACCCCAATGTT
AGCCACGGCTCCTGCTCATGCCCTCAGGCTCAGGTACGTGGCTCCCTCGCGCTTGTGGTTTCATAAGTTCCGATGCTCCT
CCTCCTCCTCCTCCTCCGCGGTTCCTCTCGCTAACCTCTCTGATTCTGAGCTCTCCGGCGGTAACAACACACTGAAGGCG
AACGAAGACAAGAACAACAGCGAGAAGAAAACGGCGCCGTATTACCCGAAACGAGGGCAGACGGTGGAGCTTGTCTGCGA
GAGTTTGGGGTTTAAGGGAAAAGGAATCTGCAAGGTCGATGGCACTGGCTTCGTCGTCATGTGCGACCGTGCTCTTCCCG
GCGAGCGTTTTCTCGGCCGCGTCACTCGCCGCAAAGGCAGCTACGCCGAGGTGACAAAGATCAAGACTTTAACTCCACAC
CGTGACTTGGTAGAAGCTCCATGTGAGTACGCTTCCTACTGTGGTGGTTGCAAAGCTCAGAATCTCTCCTACGAAGCTCA
GCTTAGAGCTAAAGAAGAACAAGTTCATGAGCTCATCACTCATGTCGGAAGGTTCTCTGATAATAATCCAGGTCTCGAGA
CTGTCTTGAAGCCTATTGTTCCTTGTGATATCCAGTTCAATTACCGTAACAAGATGGAATTTTCATTTGGTCCACAAAGA
TGGCTTCCTGTTGAAATGTTGCACGAGAGAGAAGATGGTCCTATGAGCTTTGCGTTGGGGCTACACGCTCCTGGGTTTTT
TGACAAGGTTTTGAATGTCGACAAGTGCTTGTTACAAAGCGAGCCTGCAAACATGGTTCTTGCTGCTGTTCAAGATTGCT
GGAGAGATCCTGAACTAAATCTTTCGCCCTATAATGCTCGTTCACATGCCGGGTTTCTTAAACATTTGATGCTTAGAACT
GGAAGGAATGTGGAGACTGGTTCACAAGAACTCATGGTCAATTTTGTGACATCCTCTTATAAGCCAGAGCTGTTGAAGCC
CCTGGTTGATAAAGTCTCATCAATTCCGGAAGTGGTAAGCATCATGAACAATGTAAATTCCTCTGTTGGAAATACATCTG
TTGGGGAACAAGAGTATACACTTTACGGTAAAGAAACAATCGCAGAGGTCTTGAGAGACCTTACCTTCCAAATCTCAGCC
AACTCTTTCTTTCAGACTAACACTCATCAGGCTGAAGTTCTGTATAAGCTAATTGAGGAATGTGCTGGACTTAAAGGAGA
TGGCTCAGAAGTGGTGCTTGATCTTTTCTGTGGAACTGGTACAGTTGGTCTTACACTTGCCAGAAGGGCGAAGCATGTGT
ATGGTTATGAAGTAGTTCCACAGGCAATAACAGATGCACACAAGAATGCTCAAATAAACGGCATAGAGAATGCAACATTC
ATCCAAGGGGATCTTAATAAAATAGGAGAGGATTTTGGGAGCAATTTTCCTAAACCTGATATCGTTATTTCTGATCCCAA
TCGGCCTGGTATGCACATGAAGTTGATCAAGTTTCTGCTAAACCTTAAATCTCCACGGATCATATATGTTTCATGTAATC
CTGCAACCTGCGCTAGGGATCTTGATTATCTTTGTCATGGCGTGGAGGAGAAGAATATAAAGGGGTGCTACAAACTGATG
AGTGTGCAGCCAGTGGATATGTTCCCTCACACTCCTCACATCGAATGTGTCTGCTTGCTTGAGCTTTCTTGA