Details for Kale Locus Bo5g101190

Position : C5 ( 5`- 32487320 .. 32489889 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g101190

Protein [Map View]
MGGMKDEANRITIPPLFPRAHVNDTGRGGLPQPFAGKSKRYPLPSPTNKICDSPSTLSLSLAPQANNTRLHGRPEKSQFT
KICNTSPASKFEGKVNHPSARGSSVTNTKSSSIIQNEYHFKNLTNLDSLKVPLVRRSETNPQANTDLSLQFCNSSSSIDG
GGGEAAGSKVALNNLHIRELLLQDESKRGSLNMMKTQLYRRRALDVFNIETQKKLKTVPPREQDVSDSSAIDSLSGMGAS
SNDVARVIGDKMFWKMRTYMINQQKIFAAQVFELHRLIMVQNMVAKSPNLVLESKLNGLRSGTMVASKVKKPNTENHKPV
TEEYPEHMKPKLPLPSITKELMKPIWQQQLLPPPGNQWLVPVMSSSEGLVYKPYAGPCPPPPSAFMVPIYGQDSLDTSAF
KFPVSTQFSHNYFPQPNARTAVLDQTNPFGQLQRWSSTSSHMTQAIPFSLKKSQESNDSDVHGSTASSPPEKPKFDVLPL
FPTEPTHHNDEHEQKQQPLHRAIKAIPHNSTSASESAARIFRSIQEERRDSDHMNS*

DNA
ATGGGAGGAATGAAAGATGAGGCAAATAGGATAACAATTCCTCCATTGTTTCCAAGAGCTCATGTCAATGATACTGGAAG
AGGAGGCTTGCCTCAGCCATTTGCTGGCAAATCAAAACGTTACCCTCTTCCTTCTCCGACCAACAAGATCTGTGATTCTC
CTTCCACACTCTCTCTGTCTCTTGCTCCCCAAGCCAACAACACCCGTCTCCATGGTCGACCTGAAAAGAGTCAGTTTACA
AAAATCTGCAACACTTCTCCAGCATCAAAGTTTGAGGGGAAGGTGAATCATCCAAGTGCCAGAGGATCATCAGTTACTAA
TACTAAGTCTAGTTCAATAATACAAAATGAGTACCATTTCAAGAACCTTACCAACTTGGATTCTCTTAAGGTTCCTCTAG
TTAGACGCTCGGAAACAAATCCACAAGCAAACACAGATTTATCACTCCAGTTTTGTAATAGTAGTAGCAGCATAGATGGA
GGAGGTGGAGAAGCTGCTGGTTCCAAGGTTGCCCTGAACAATCTTCACATTCGAGAATTACTTTTGCAAGATGAAAGCAA
GAGAGGGTCTCTTAACATGATGAAAACTCAGTTGTATAGGAGAAGAGCCCTTGATGTATTTAACATTGAAACTCAAAAGA
AGCTCAAAACTGTGCCTCCACGTGAACAAGATGTCTCAGACTCTTCTGCAATAGACTCTTTGTCTGGTATGGGTGCTTCA
TCTAATGATGTTGCTAGAGTGATAGGTGACAAGATGTTTTGGAAGATGAGAACTTATATGATCAACCAGCAGAAGATCTT
TGCAGCACAAGTCTTTGAGCTTCATAGGCTGATAATGGTTCAAAACATGGTTGCAAAATCACCAAACCTGGTTCTTGAAA
GTAAGCTTAATGGCCTAAGAAGTGGTACAATGGTTGCTTCAAAGGTTAAGAAACCAAACACAGAGAATCACAAACCTGTA
ACCGAAGAATATCCAGAACATATGAAACCAAAGCTTCCTCTGCCTTCCATAACCAAAGAGCTTATGAAACCGATTTGGCA
ACAACAGCTACTTCCTCCTCCTGGAAACCAATGGTTAGTTCCGGTAATGTCTTCTTCAGAAGGTCTGGTCTATAAACCAT
ACGCAGGACCATGTCCTCCTCCTCCCTCAGCCTTCATGGTTCCAATCTATGGACAAGATTCGCTCGACACATCAGCATTC
AAGTTCCCTGTTTCTACTCAGTTTAGCCACAACTACTTCCCGCAGCCTAACGCTAGGACAGCAGTACTTGACCAGACAAA
CCCGTTTGGTCAGCTTCAAAGATGGTCTAGCACATCGAGCCACATGACTCAAGCCATTCCATTTTCTTTAAAGAAGTCTC
AGGAATCTAATGACAGTGATGTACATGGAAGTACAGCTTCAAGTCCACCAGAGAAGCCTAAATTCGATGTACTTCCTCTA
TTTCCTACAGAGCCTACTCATCACAATGATGAGCATGAGCAGAAACAGCAACCTCTGCACCGTGCCATTAAAGCCATTCC
TCATAATTCAACATCAGCCTCTGAATCTGCTGCAAGAATTTTCCGTTCCATTCAAGAAGAAAGGAGGGACTCAGATCATA
TGAATAGTTAG